CATH Domain: 1tafA00 XML data for domain: 1tafA00

Molscript image for 1tafA00
1tafA00
PDB coordinates for domain 1tafA00

PDB 1taf, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.20 Histone, subunit A
1.10.20.10 Histone, subunit A Gene3D
1.10.20.10.15
1.10.20.10.15.1
1.10.20.10.15.1.1
1.10.20.10.15.1.1.1
1.10.20.10.15.1.1.1.1

[top]
Segment boundaries for domain 1tafA00

Chopping figure for domain 1tafA00
DomainStart PDB ResidueStop PDB Residue
1tafA00 19 86

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 1.10.20.10.15.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1h3oB00 88.26 General RNA polymerase II transcription factor activityTranscription initiation factor TFIID subunit 12STAGA complexHistone H3 acetylationPlasma membrane 1.10.20.10 71 19 92 1.93 2.08
1jfiA00 87.62 Sequence-specific DNA binding transcription factor activityTranscription corepressor activityHomo sapiensNegative regulation of transcription from RNA polymerase II promoterDr1-associated corepressor 1.10.20.10 63 12 91 2.17 2.38
1h3oA00 82.58 General RNA polymerase II transcription factor activityTranscription coactivator activityBasal transcription factorsTranscription factor TFIID complexCytoplasm 1.10.20.10 48 16 65 1.68 2.56
1bh9A00 82.55 Basal transcription factorsTranscription factor TFIID complexTranscription initiation factor TFIID subunit D11Protein C-terminus bindingTranscription initiation factor TFIID subunit 13 1.10.20.10 45 8 65 1.75 2.66
1jfiB00 77.39 Protein Dr1Transcription corepressor activityHomo sapiensNegative regulation of transcription from RNA polymerase II promoter 1.10.20.10 135 19 49 1.77 3.57
1kx5A00 76.76 Systemic lupus erythematosusHistone H3.2Xenopus laevisHistone H3 1.10.20.10 135 20 49 1.54 3.10
1q9cA01 71.39 Jak-STAT signaling pathwayPathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayNon-small cell lung cancer 1.10.20.10 145 16 41 1.97 4.76
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tafA00
PKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVTSILDDAKVYANHARKKTIDLDDVRLATEVTLD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tafA00
PKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVTSILDDAKVYANHARKKTIDLDDVRLATEVTLD
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:24

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"