CATH Domain: 1ta8A03 XML data for domain: 1ta8A03

Molscript image for 1ta8A03
1ta8A03
PDB coordinates for domain 1ta8A03

PDB 1ta8, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.470 D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.30 DNA ligase/mRNA capping enzyme Gene3D
3.30.470.30.2
3.30.470.30.2.1
3.30.470.30.2.1.1
3.30.470.30.2.1.1.1
3.30.470.30.2.1.1.1.1

[top]
Segment boundaries for domain 1ta8A03

Chopping figure for domain 1ta8A03
DomainStart PDB ResidueStop PDB Residue
1ta8A01 5 68
1ta8A02 88 122
1ta8A02 254 317
1ta8A03 124 253

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.470.30.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1x9nA03 77.81 DNA replicationNucleotide excision repairDNA ligase 1Base excision repairDNA binding 3.30.470.30 126 10 83 3.47 4.14
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ta8A03
LAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRN
AAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ta8A03
LAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRN
AAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFR
BLAST against CATH

[top]
Domain History Events (7)

Domain assigned by auto on 14 Aug 2007 22:57

Assigning to "3.30.470.30" based on similarity with "1taeA03"

Flow stage update by auto on 14 Aug 2007 22:46

No in_process hits for Domain "1ta8A03" ready to be processed

Flow stage update by auto on 18 Jul 2007 22:36

Domain "1ta8A03" hits Domain "1taeB03" (100% over 100%) which is currently in process

Flow stage update by auto on 18 Jul 2007 22:35

NW result present for Domain "1ta8A03"

Flow stage update by auto on 16 Jul 2007 22:37

All required files are present for Domain "1ta8A03"

Flow stage update by auto on 14 Jul 2007 06:01

Beginning processing for Domain "1ta8A03"

Insertion by auto on 14 Jul 2007 04:21

Final ChopClose added based on similarity with "1b04A"