CATH Domain: 1ta8A02 XML data for domain: 1ta8A02

Molscript image for 1ta8A02
1ta8A02
PDB coordinates for domain 1ta8A02

PDB 1ta8, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.70 Gene3D
3.30.1490.70.2
3.30.1490.70.2.1
3.30.1490.70.2.1.1
3.30.1490.70.2.1.1.1
3.30.1490.70.2.1.1.1.1

[top]
Segment boundaries for domain 1ta8A02

Chopping figure for domain 1ta8A02
DomainStart PDB ResidueStop PDB Residue
1ta8A01 5 68
1ta8A02 88 122
1ta8A02 254 317
1ta8A03 124 253

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.1490.70.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1v9pA02 92.20 DNA ligaseThermus filiformis 3.30.1490.70 98 34 95 1.40 1.46
1a0iA01 82.07 Enterobacteria phage T7DNA ligase 3.30.1490.70 83 13 75 3.34 4.41
1x9nA02 80.27 Nucleotide excision repairDNA replicationDNA ligase 1Base excision repairDNA binding 3.30.1490.70 83 13 77 3.41 4.38
1svdM00 77.15 Ribulose bisphosphate carboxylase small chainCarbon fixation in photosynthetic organismsHalothiobacillus neapolitanus c2Ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]Glyoxylate and dicarboxylate metabolism 3.30.190.10 108 12 76 3.52 4.58
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ta8A02
SLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQ
DELGFTVKAPRWAIAYKFP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ta8A02
SLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQ
DELGFTVKAPRWAIAYKFPPEEAETVVXHHHHHH
BLAST against CATH

[top]
Domain History Events (7)

Domain assigned by auto on 14 Aug 2007 22:57

Assigning to "3.30.1490.70" based on similarity with "1taeC02"

Flow stage update by auto on 14 Aug 2007 22:46

No in_process hits for Domain "1ta8A02" ready to be processed

Flow stage update by auto on 18 Jul 2007 22:36

Domain "1ta8A02" hits Domain "1taeB02" (98.2456140350877% over 99.1304347826087%) which is currently in process

Flow stage update by auto on 18 Jul 2007 22:35

NW result present for Domain "1ta8A02"

Flow stage update by auto on 16 Jul 2007 22:37

All required files are present for Domain "1ta8A02"

Flow stage update by auto on 14 Jul 2007 06:01

Beginning processing for Domain "1ta8A02"

Insertion by auto on 14 Jul 2007 04:21

Final ChopClose added based on similarity with "1b04A"