CATH Domain: 1ta8A01 XML data for domain: 1ta8A01

Molscript image for 1ta8A01
1ta8A01
PDB coordinates for domain 1ta8A01

PDB 1ta8, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.287 Helix Hairpins
1.10.287.610 Helix hairpin bin Gene3D
1.10.287.610.1
1.10.287.610.1.1
1.10.287.610.1.1.1
1.10.287.610.1.1.1.1
1.10.287.610.1.1.1.1.1

[top]
Segment boundaries for domain 1ta8A01

Chopping figure for domain 1ta8A01
DomainStart PDB ResidueStop PDB Residue
1ta8A01 5 68
1ta8A02 88 122
1ta8A02 254 317
1ta8A03 124 253

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 1.10.287.610.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1b04A03 93.13 Geobacillus stearothermophilusDNA ligase 1.10.287.610 62 56 96 1.68 1.73
1sf9A01 84.85 Bacillus subtilisUncharacterized protein yfhH 1.10.287.880 64 6 68 1.97 2.87
1skvA00 83.57 Protein D-63Sulfolobus virus 1 1.10.287.660 62 8 70 2.24 3.19
1wb7A01 83.41 Superoxide dismutase, Fe-Mn family [EC:1.15.1.1]Sulfolobus solfataricusSuperoxide dismutase [Fe] 1.10.287.990 67 1 83 4.14 4.95
1bsmA01 83.21 Superoxide dismutase [Mn/Fe]Propionibacterium freudenreichii subsp. shermanii 1.10.287.990 64 3 87 4.17 4.77
3bz1Z00 81.76 PhotosynthesisThermosynechococcus elongatus BP-1Photosystem II reaction center protein ZPhotosystem II PsbZ proteinMetabolic pathways 1.10.287.740 62 8 73 2.24 3.05
1n8iA04 77.18 Pyruvate metabolismGlyoxylate and dicarboxylate metabolismMetabolic pathwaysMalate synthase GMalate synthase [EC:2.3.3.9] 1.20.1220.12 108 3 56 2.47 4.37
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ta8A01
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ta8A01
MEQQPLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQR
BLAST against CATH

[top]
Domain History Events (7)

Domain assigned by auto on 14 Aug 2007 22:57

Assigning to "1.10.287.610" based on similarity with "1taeD01"

Flow stage update by auto on 14 Aug 2007 22:46

No in_process hits for Domain "1ta8A01" ready to be processed

Flow stage update by auto on 18 Jul 2007 22:36

Domain "1ta8A01" hits Domain "1taeB01" (100% over 88.2352941176471%) which is currently in process

Flow stage update by auto on 18 Jul 2007 22:35

NW result present for Domain "1ta8A01"

Flow stage update by auto on 16 Jul 2007 22:37

All required files are present for Domain "1ta8A01"

Flow stage update by auto on 14 Jul 2007 06:01

Beginning processing for Domain "1ta8A01"

Insertion by auto on 14 Jul 2007 04:21

Final ChopClose added based on similarity with "1b04A"