CATH Domain: 1t9bB01 XML data for domain: 1t9bB01

Molscript image for 1t9bB01
1t9bB01
PDB coordinates for domain 1t9bB01

PDB 1t9b, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.970 Gene3D
3.40.50.970.21
3.40.50.970.21.1
3.40.50.970.21.1.1
3.40.50.970.21.1.1.1
3.40.50.970.21.1.1.1.1

[top]
Segment boundaries for domain 1t9bB01

Chopping figure for domain 1t9bB01
DomainStart PDB ResidueStop PDB Residue
1t9bB01 85 269
1t9bB02 278 459
1t9bB03 460 687

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.50.970.21.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1yd7A00 83.38 Pyrococcus furiosus2-oxoglutarate ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3]Citrate cycle (TCA cycle)2-keto acid:ferredoxin oxidoreductase subunit alphaMetabolic pathways 3.40.50.970 162 14 79 3.45 4.34
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1t9bB01
MDTSFVGLTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYARASGKPGVVLVTSG
PGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVGISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGP
VLVDLPKDVTAAILRNPIPTKTTLP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1t9bB01
MDTSFVGLTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYARASGKPGVVLVTSG
PGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVGISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGP
VLVDLPKDVTAAILRNPIPTKTTLP
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 20 Aug 2007 10:28

Assigning to "3.40.50.970" based on similarity with "1t9aB01"

Flow stage update by auto on 20 Aug 2007 10:28

No in_process hits for Domain "1t9bB01" ready to be processed

Update comment by auto on 20 Aug 2007 10:25

Domain "1t9bB01" hits Domain "1t9bA01" (100% over 96.7567567567568%) which is currently in process

Update comment by auto on 20 Aug 2007 10:19

Domain "1t9bB01" hits Domain "1t9cB01" (100% over 99.4623655913979%) which is currently in process

Update comment by auto on 20 Aug 2007 10:12

Domain "1t9bB01" hits Domain "1t9cA01" (100% over 99.4623655913979%) which is currently in process

Flow stage update by auto on 20 Aug 2007 10:09

Domain "1t9bB01" hits Domain "1t9cA01" (100% over 99.4623655913979%) which is currently in process

Flow stage update by auto on 20 Aug 2007 10:09

NW result present for Domain "1t9bB01"

Flow stage update by auto on 16 Aug 2007 17:15

All required files are present for Domain "1t9bB01"

Flow stage update by auto on 16 Aug 2007 00:02

Beginning processing for Domain "1t9bB01"

Insertion by auto on 15 Aug 2007 19:12

Final ChopClose added based on similarity with "1t9bA"