CATH Domain: 1t9bA03 XML data for domain: 1t9bA03

Molscript image for 1t9bA03
1t9bA03
PDB coordinates for domain 1t9bA03

PDB 1t9b, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.970 Gene3D
3.40.50.970.12
3.40.50.970.12.1
3.40.50.970.12.1.1
3.40.50.970.12.1.1.1
3.40.50.970.12.1.1.1.1

[top]
Segment boundaries for domain 1t9bA03

Chopping figure for domain 1t9bA03
DomainStart PDB ResidueStop PDB Residue
1t9bA01 85 263
1t9bA02 284 459
1t9bA03 460 687

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.970.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ybhA03 90.15 ChloroplastAcetolactate synthase I/II/III large subunit [EC:2.2.1.6]Acetolactate synthase, chloroplasticValine, leucine and isoleucine biosynthesisMetabolic pathways 3.40.50.970 194 41 81 1.14 1.40
1ozhB03 85.94 Acetolactate synthase, catabolicKlebsiella pneumoniae 3.40.50.970 196 26 84 2.27 2.68
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1t9bA03
YAYMEETPGSKIKPQTVIKKLSKVANDTGRHVIVTTGVGQHQMWAAQHWTWRNPHTFITSGGLGTMGYGLPAAIGAQVAK
PESLVIDIDGDASFNMTLTELSSAVQAGTPVKILILNNEEQGMVTQWQSLFYEHRYSHTHQLNPDFIKLAEAMGLKGLRV
KKQEELDAKLKEFVSTKGPVLLEVEVDKKVPVLPMVAGGSGLDEFINFDPEVERQQTELRHKRTGGKH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1t9bA03
YAYMEETPGSKIKPQTVIKKLSKVANDTGRHVIVTTGVGQHQMWAAQHWTWRNPHTFITSGGLGTMGYGLPAAIGAQVAK
PESLVIDIDGDASFNMTLTELSSAVQAGTPVKILILNNEEQGMVTQWQSLFYEHRYSHTHQLNPDFIKLAEAMGLKGLRV
KKQEELDAKLKEFVSTKGPVLLEVEVDKKVPVLPMVAGGSGLDEFINFDPEVERQQTELRHKRTGGKH
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 20 Aug 2007 10:28

Assigning to "3.40.50.970" based on similarity with "1t9cA03"

Flow stage update by auto on 20 Aug 2007 10:28

No in_process hits for Domain "1t9bA03" ready to be processed

Update comment by auto on 20 Aug 2007 10:25

Domain "1t9bA03" hits Domain "1t9cB03" (100% over 100%) which is currently in process

Update comment by auto on 20 Aug 2007 10:19

Domain "1t9bA03" hits Domain "1t9bB03" (100% over 100%) which is currently in process

Update comment by auto on 20 Aug 2007 10:12

Domain "1t9bA03" hits Domain "1t9cA03" (100% over 100%) which is currently in process

Flow stage update by auto on 20 Aug 2007 10:09

Domain "1t9bA03" hits Domain "1t9cA03" (100% over 100%) which is currently in process

Flow stage update by auto on 20 Aug 2007 10:09

NW result present for Domain "1t9bA03"

Flow stage update by auto on 16 Aug 2007 17:15

All required files are present for Domain "1t9bA03"

Flow stage update by auto on 16 Aug 2007 00:02

Beginning processing for Domain "1t9bA03"

Insertion by auto on 15 Aug 2007 18:56

Final ChopClose added based on similarity with "1n0hA"