CATH Domain: 1t90A02 XML data for domain: 1t90A02

Molscript image for 1t90A02
1t90A02
PDB coordinates for domain 1t90A02

PDB 1t90, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.309 Aldehyde Dehydrogenase; Chain A, domain 2
3.40.309.10 Aldehyde Dehydrogenase; Chain A, domain 2 Gene3D
3.40.309.10.8
3.40.309.10.8.1
3.40.309.10.8.1.1
3.40.309.10.8.1.1.1
3.40.309.10.8.1.1.1.1

[top]
Segment boundaries for domain 1t90A02

Chopping figure for domain 1t90A02
DomainStart PDB ResidueStop PDB Residue
1t90A01 3 251
1t90A01 451 481
1t90A02 252 450

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.309.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ad3A02 87.08 Tyrosine metabolismRattus norvegicusResponse to glucocorticoid stimulus3-chloroallyl aldehyde dehydrogenase activityCytosol 3.40.309.10 195 20 94 2.79 2.94
1o20A02 84.21 Thermotoga maritimaGamma-glutamyl phosphate reductaseArginine and proline metabolismGlutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]Metabolic pathways 3.40.309.10 149 23 69 2.10 3.01
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1t90A02
GAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEFMAKLQEKVADIKIGNGLDDGVFLGPVIREDN
KKRTLSYIEKGLEEGARLVCDGRENVSDDGYFVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANG
ACLFTSNSNAIRYFRENIDAGMLGINLGVPAPMAFFPFS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1t90A02
GAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEFMAKLQEKVADIKIGNGLDDGVFLGPVIREDN
KKRTLSYIEKGLEEGARLVCDGRENVSDDGYFVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANG
ACLFTSNSNAIRYFRENIDAGMLGINLGVPAPMAFFPFS
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 06 Sep 2007 02:23

Assigning to "3.40.309.10" based on similarity with "1t90C02"

Flow stage update by auto on 06 Sep 2007 02:18

No in_process hits for Domain "1t90A02" ready to be processed

Update comment by auto on 05 Sep 2007 18:43

Domain "1t90A02" hits Domain "1t90C02" (100% over 100%) which is currently in process

Flow stage update by auto on 05 Sep 2007 18:38

Domain "1t90A02" hits Domain "1t90C02" (100% over 100%) which is currently in process

Flow stage update by auto on 05 Sep 2007 18:38

NW result present for Domain "1t90A02"

Flow stage update by auto on 04 Sep 2007 14:04

All required files are present for Domain "1t90A02"

Flow stage update by auto on 03 Sep 2007 20:09

Beginning processing for Domain "1t90A02"

Insertion by auto on 03 Sep 2007 18:11

Final ChopClose added based on similarity with "1t90C"