CATH Domain: 1t8kA00 XML data for domain: 1t8kA00

Molscript image for 1t8kA00
1t8kA00
PDB coordinates for domain 1t8kA00

PDB 1t8k, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1200 Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A
1.10.1200.10 Gene3D
1.10.1200.10.1
1.10.1200.10.1.1
1.10.1200.10.1.1.1
1.10.1200.10.1.1.1.1
1.10.1200.10.1.1.1.1.1

[top]
Segment boundaries for domain 1t8kA00

Chopping figure for domain 1t8kA00
DomainStart PDB ResidueStop PDB Residue
1t8kA00 1 77

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 1.10.1200.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ce7A00 87.45 ToxoplasmaSpecific mitochodrial acyl carrier protein 1.10.1200.10 84 27 85 2.51 2.93
1dnyA00 86.38 Brevibacillus parabrevisTyrocidine synthase 3 1.10.1200.10 76 19 92 2.18 2.36
1dv5A00 86.03 D-Alanine metabolismD-alanine--poly(phosphoribitol) ligase subunit 2D-alanine-poly(phosphoribitol) ligase [EC:6.1.1.13]Lactobacillus rhamnosus 1.10.1200.10 80 22 95 2.57 2.71
2avaA00 85.35 Spinacia oleraceaAcyl carrier protein 1, chloroplastic 1.10.1200.10 82 33 92 3.31 3.57
1or5A00 84.38 Streptomyces roseofulvusAcyl carrier protein 1.10.1200.10 82 22 92 2.78 3.00
2cnrA00 81.73 Acyl carrier proteinAcyl carrier proteinStreptomyces coelicolor 1.10.1200.10 82 27 89 2.98 3.35
2jq4A00 80.86 Agrobacterium tumefaciens str. C58Acyl carrier protein, putative 1.10.1200.10 83 19 89 2.72 3.05
1klpA00 78.03 Meromycolate extension acyl carrier proteinAcyl carrier proteinMycobacterium tuberculosis 1.10.1200.10 115 33 66 2.78 4.15
1l8qA02 76.66 Two-component systemChromosomal replication initiator proteinChromosomal replication initiator protein dnaAAquifex aeolicus 1.10.8.60 49 16 55 2.33 4.17
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1t8kA00
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1t8kA00
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:52

Cut based on decision in database "DomChop" on "cathdb"