CATH Domain: 1t6cA01 XML data for domain: 1t6cA01

Molscript image for 1t6cA01
1t6cA01
PDB coordinates for domain 1t6cA01

PDB 1t6c, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.4
3.30.420.40.4.1
3.30.420.40.4.1.1
3.30.420.40.4.1.1.1
3.30.420.40.4.1.1.1.1

[top]
Segment boundaries for domain 1t6cA01

Chopping figure for domain 1t6cA01
DomainStart PDB ResidueStop PDB Residue
1t6cA01 7 131
1t6cA02 132 312

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.30.420.40.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3cerC01 90.15 Possible exopolyphosphatase-like proteinBifidobacterium longum 3.30.420.40 127 30 97 1.87 1.92
1huxA01 79.27 Activator of (R)-2-hydroxyglutaryl-CoA dehydrataseAcidaminococcus fermentans DSM 20731 3.30.420.40 119 7 68 3.10 4.56
1e4fT03 79.21 Thermotoga maritimaCell division protein FtsA, putativeCell division protein FtsA 3.30.420.40 136 9 79 3.54 4.46
2ap1A01 78.55 Amino sugar and nucleotide sugar metabolismN-acetylglucosamine kinase [EC:2.7.1.59]Salmonella enterica subsp. enterica serovar TyphimuriumN-acetyl-D-glucosamine kinase 3.30.420.40 137 8 75 3.35 4.46
3h1qA02 77.66 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 113 15 73 3.52 4.78
1woqA01 77.52 Inorganic polyphosphate/ATP-glucomannokinaseArthrobacter sp. KM 3.30.420.40 112 9 72 3.39 4.71
1jcfA02 77.07 Thermotoga maritimaRod shape-determining protein MreB and related proteinsRod shape-determining protein MreB 3.30.420.40 89 10 67 3.35 4.99
1ewqA02 76.71 Thermus aquaticusDNA mismatch repair protein mutS 3.30.420.110 117 6 68 3.39 4.99
3cetB01 74.58 Methanococcus maripaludisConserved archaeal protein 3.30.420.40 108 12 66 3.02 4.55
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1t6cA01
PIMRVASIDIGSYSVRLTIAQIKDGKLSIILERGRITSLGTKVKETGRLQEDRIEETIQVLKEYKKLIDEFKVERVKAVA
TEAIRRAKNAEEFLERVKREVGLVVEVITPEQEGRYAYLAVAYSL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1t6cA01
GSHMSLDNKPIMRVASIDIGSYSVRLTIAQIKDGKLSIILERGRITSLGTKVKETGRLQEDRIEETIQVLKEYKKLIDEF
KVERVKAVATEAIRRAKNAEEFLERVKREVGLVVEVITPEQEGRYAYLAVAYSL
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:52

Cut based on decision in database "DomChop" on "cathdb"