CATH Domain: 1t5hX04 XML data for domain: 1t5hX04

Molscript image for 1t5hX04
1t5hX04
PDB coordinates for domain 1t5hX04

PDB 1t5h, Chain X, Domain 4

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.30 Gene3D
3.30.300.30.5
3.30.300.30.5.1
3.30.300.30.5.1.1
3.30.300.30.5.1.1.1
3.30.300.30.5.1.1.1.1

[top]
Segment boundaries for domain 1t5hX04

Chopping figure for domain 1t5hX04
DomainStart PDB ResidueStop PDB Residue
1t5hX01 2 174
1t5hX02 175 321
1t5hX03 322 401
1t5hX04 402 503

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.300.30.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1lciA04 90.07 Photinus pyralisLuciferin 4-monooxygenasePeroxisome 3.30.300.30 99 23 93 1.62 1.74
1amuA04 89.37 Aneurinibacillus migulanusGramicidin S synthase 1 3.30.300.30 96 20 90 1.41 1.56
2j8sA03 75.73 Hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 familyAcriflavine resistance protein BProtein bindingEscherichia coli K-12 3.30.70.1320 100 11 72 3.52 4.87
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1t5hX04
DDIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALDTFCRSSELADFKRPKRYFIL
DQLPKNALNKVLRRQLVQQVS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1t5hX04
DDXIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALDTFCRSSELADFKRPKRYFI
LDQLPKNALNKVLRRQLVQQVSS
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:51

Cut based on decision in database "DomChop" on "cathdb"