CATH Domain: 1t4gA01 XML data for domain: 1t4gA01

Molscript image for 1t4gA01
1t4gA01
PDB coordinates for domain 1t4gA01

PDB 1t4g, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.20 5' to 3' exonuclease, C-terminal subdomain Gene3D
1.10.150.20.11
1.10.150.20.11.1
1.10.150.20.11.1.1
1.10.150.20.11.1.1.1
1.10.150.20.11.1.1.1.2

[top]
Segment boundaries for domain 1t4gA01

Chopping figure for domain 1t4gA01
DomainStart PDB ResidueStop PDB Residue
1t4gA01 5 66
1t4gA02 67 322

Structural Neighbourhood (18 entries)

There are 18 matching structural neighberhood comparisons for CATH ID 1.10.150.20.11.1.1.1.2 (SIMAX score < 5)

[1]
Displaying entries 1 to 18 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1y88A02 91.76 Archaeoglobus fulgidusUncharacterized protein AF_1548 1.10.150.20 59 25 91 2.06 2.24
1szpA01 89.05 DNA repair protein RAD51Identical protein bindingDouble-strand break repair via homologous recombinationHeteroduplex formationDNA-dependent ATPase activity 1.10.150.20 72 32 86 1.60 1.86
2dflA01 87.98 DNA repair and recombination protein radASulfolobus solfataricusDNA repair protein RadA 1.10.150.20 60 36 95 1.73 1.82
1wcnA01 86.33 N utilization substance protein ATranscription elongation protein nusAEscherichia coli K-12 1.10.150.20 60 30 90 2.06 2.28
1dxsA00 85.79 DNA damage response, signal transduction resulting in induction of apoptosisTranscription factor bindingProtein bindingPositive regulation of transcription, DNA-dependentMismatch repair 1.10.150.50 57 19 85 1.97 2.30
2q0zX02 85.51 ATP-dependent helicase activityPre-mRNA-splicing helicase BRR2 [EC:3.6.1.-]Protein bindingU5 small nuclear ribonucleoprotein 200 kDa helicaseU5 snRNP 1.10.150.20 56 12 85 2.46 2.88
1x9xA00 85.49 MAPK signaling pathway - yeastSAM domain bindingIdentical protein bindingInvasive growth in response to glucose limitationActivation of MAPKK activity 1.10.150.50 62 4 91 2.35 2.56
2ztdA02 84.84 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAHolliday junction DNA helicase RuvAMycobacterium tuberculosis 1.10.150.20 68 25 83 2.61 3.11
1bvsA02 84.25 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAMycobacterium lepraeHolliday junction DNA helicase RuvA 1.10.150.20 70 22 85 3.73 4.35
3kkaD00 83.58 Integral to plasma membraneEphrin type-A receptor 2Protein bindingSignal transductionEph receptor A2 [EC:2.7.10.1] 1.10.150.50 68 17 83 2.54 3.03
1dgsA05 83.13 DNA ligaseThermus filiformis 1.10.150.20 69 19 78 2.89 3.69
3h8mA00 82.69 EphA7 [EC:2.7.10.1]Homo sapiensEphrin type-A receptor 7Axon guidance 1.10.150.50 71 9 84 3.07 3.63
1b4fA00 82.17 Ephrin type-B receptor 2Homo sapiensTransmembrane-ephrin receptor activity 1.10.150.50 74 9 82 2.88 3.49
1v38A00 81.59 Mus musculusSAM domain-containing protein SAMSN-1 1.10.150.50 78 11 78 2.76 3.53
1oxjA01 81.45 Cytoplasmic mRNA processing bodyNuclear-transcribed mRNA poly(A) tail shorteningEstablishment of RNA localizationProtein SmaugDrosophila melanogaster 1.10.150.50 61 13 82 3.14 3.82
1z1vA00 81.42 Protein kinase regulator activitySAM domain bindingProtein STE50Signal transduction involved in filamentous growthPheromone-dependent signal transduction involved in conjugation with cellular fusion 1.10.150.50 70 11 81 2.48 3.05
1pk3A00 78.88 PRC1 complexIdentical protein bindingNegative regulation of transcriptionPolycomb protein ScmAxonogenesis 1.10.150.50 76 4 69 2.62 3.76
1x66A01 77.29 Sequence-specific DNA binding transcription factor activityHemostasisOrgan morphogenesisHomo sapiensFriend leukemia integration 1 transcription factor 1.10.150.50 70 4 75 3.67 4.85
[1]
Displaying entries 1 to 18 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1t4gA01
LTDLPGVGPSTAEKLVEAGYIDFMKIATATVGELTDIEGISEKAAAKMIMGARDLCDLGFKS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1t4gA01
MGDNLTDLPGVGPSTAEKLVEAGYIDFMKIATATVGELTDIEGISEKAAAKMIMGARDLCDLGFKS
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:15

Assigning to "1.10.150.20" based on similarity with "1pznA01" (NWSI: 48.4848484848485, NWO: 96.969696969697, SPS: 85.92, SPO: 90, RMSD: 3.88)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1t4gA01"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1t4gA01"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1t4gA01"

Insertion by auto on 05 Mar 2006 23:51

Cut based on decision in database "DomChop" on "cathdb"