Domain assigned by auto on 15 Aug 2007 09:10
Assigning to "3.30.360.10" based on similarity with "1t4dA02"
CATH Domain: 1t4bA02
1t4bA02
PDB 1t4b, Chain A, Domain 2
Segment boundaries for domain 1t4bA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1t4bA01 | 1 | 134 |
| 1t4bA01 | 351 | 367 |
| 1t4bA02 | 135 | 350 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|1t4bA02 CTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYGHVADELATPSSAILDIERKVTTLTRSGELP VDNFGVPLAGSLIPWIDKQLDNGQSREEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEEL LAAHNPWAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQ
Domain History Events (26)
Flow stage update by auto on 15 Aug 2007 09:09
No in_process hits for Domain "1t4bA02" ready to be processed
Update comment by auto on 15 Aug 2007 09:05
Domain "1t4bA02" hits Domain "1q2xB02" (69.9074074074074% over 99.0783410138249%) which is currently in process
Update comment by auto on 15 Aug 2007 08:57
Domain "1t4bA02" hits Domain "1q2xA02" (69.9074074074074% over 99.0783410138249%) which is currently in process
Update comment by auto on 15 Aug 2007 08:43
Domain "1t4bA02" hits Domain "1ps8A02" (70.3703703703704% over 99.0825688073395%) which is currently in process
Update comment by auto on 15 Aug 2007 08:21
Domain "1t4bA02" hits Domain "1pquB02" (70.3703703703704% over 99.0825688073395%) which is currently in process
Update comment by auto on 15 Aug 2007 08:00
Domain "1t4bA02" hits Domain "1pquC02" (70.3703703703704% over 99.0825688073395%) which is currently in process
Update comment by auto on 15 Aug 2007 07:32
Domain "1t4bA02" hits Domain "1pquD02" (70.3703703703704% over 99.0825688073395%) which is currently in process
Update comment by auto on 15 Aug 2007 07:08
Domain "1t4bA02" hits Domain "1pquA02" (70.3703703703704% over 99.0825688073395%) which is currently in process
Update comment by auto on 15 Aug 2007 06:48
Domain "1t4bA02" hits Domain "1pr3A02" (70.8333333333333% over 99.0825688073395%) which is currently in process
Update comment by auto on 15 Aug 2007 06:27
Domain "1t4bA02" hits Domain "1pqpA02" (70.3703703703704% over 99.0825688073395%) which is currently in process
Update comment by auto on 15 Aug 2007 05:59
Domain "1t4bA02" hits Domain "1ozaA02" (70.8333333333333% over 99.0825688073395%) which is currently in process
Update comment by auto on 15 Aug 2007 05:30
Domain "1t4bA02" hits Domain "1nx6A02" (70.3703703703704% over 99.0783410138249%) which is currently in process
Update comment by auto on 15 Aug 2007 05:02
Domain "1t4bA02" hits Domain "1nwhB02" (70.3703703703704% over 99.0783410138249%) which is currently in process
Update comment by auto on 15 Aug 2007 04:30
Domain "1t4bA02" hits Domain "1nwhA02" (70.3703703703704% over 99.0783410138249%) which is currently in process
Update comment by auto on 15 Aug 2007 03:56
Domain "1t4bA02" hits Domain "1nwcB02" (70.8333333333333% over 99.0825688073395%) which is currently in process
Update comment by auto on 15 Aug 2007 03:15
Domain "1t4bA02" hits Domain "1nwcA02" (70.8333333333333% over 99.0825688073395%) which is currently in process
Update comment by auto on 15 Aug 2007 02:33
Domain "1t4bA02" hits Domain "1mc4A02" (64.8148148148148% over 99.5391705069124%) which is currently in process
Update comment by auto on 15 Aug 2007 01:23
Domain "1t4bA02" hits Domain "1mb4A02" (64.8148148148148% over 99.5391705069124%) which is currently in process
Update comment by auto on 14 Aug 2007 23:56
Domain "1t4bA02" hits Domain "1mb4B02" (64.8148148148148% over 99.5391705069124%) which is currently in process
Update comment by auto on 14 Aug 2007 22:46
Domain "1t4bA02" hits Domain "1gl3B02" (100% over 100%) which is currently in process
Flow stage update by auto on 06 Aug 2007 18:34
Domain "1t4bA02" hits Domain "1t4dA02" (100% over 100%) which is currently in process
Flow stage update by auto on 06 Aug 2007 18:34
NW result present for Domain "1t4bA02"
Flow stage update by auto on 18 Jul 2007 06:53
All required files are present for Domain "1t4bA02"
Flow stage update by auto on 17 Jul 2007 10:36
Beginning processing for Domain "1t4bA02"
Insertion by auto on 17 Jul 2007 10:07
Final ChopClose added based on similarity with "1t4dB"
