Domain assigned by auto on 02 Sep 2007 18:19
Assigning to "3.90.1150.10" based on similarity with "1c0nA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1t3iA01 | 7 | 34 |
| 1t3iA01 | 302 | 414 |
| 1t3iA02 | 41 | 301 |
There are 19 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.9.1.1.1.1 (SIMAX score < 5)
>pdb|1t3iA01 PSLAATVRQDFPILNQEINGHPLVYLDNGMENIHNYEVELTHYLWQGLGQIPQLRLYGPNPKHGDRAALASFNVAGLHAS DVATMVDQDGIAIRSGHHCTQPLHRLFDASGSARASLYFYNTKEEIDLFLQSLQATIRFFS
Assigning to "3.90.1150.10" based on similarity with "1c0nA01"
No in_process hits for Domain "1t3iA01" ready to be processed
NW result present for Domain "1t3iA01"
All required files are present for Domain "1t3iA01"
Beginning processing for Domain "1t3iA01"
nice chopping