CATH Domain: 1t33B01 XML data for domain: 1t33B01

Molscript image for 1t33B01
1t33B01
PDB coordinates for domain 1t33B01

PDB 1t33, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.10 Arc Repressor Mutant, subunit A
1.10.10.60 Homeodomain-like Gene3D
1.10.10.60.14
1.10.10.60.14.1
1.10.10.60.14.1.1
1.10.10.60.14.1.1.1
1.10.10.60.14.1.1.1.2

[top]
Segment boundaries for domain 1t33B01

Chopping figure for domain 1t33B01
DomainStart PDB ResidueStop PDB Residue
1t33B01 7 62
1t33B02 63 220

Structural Neighbourhood (36 entries)

There are 36 matching structural neighberhood comparisons for CATH ID 1.10.10.60.14.1.1.1.2 (SIMAX score < 5)

[1]
Displaying entries 1 to 36 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2np3B01 93.72 Streptomyces coelicolorPutative TetR-family regulator 1.10.10.60 60 25 93 1.15 1.23
3bqzA01 90.96 HTH-type transcriptional regulator qacRStaphylococcus aureus subsp. aureus Mu50 1.10.10.60 49 26 77 0.77 0.99
1zkgA01 88.81 Thermotoga maritimaTranscriptional regulator, TetR family 1.10.10.60 46 32 72 2.09 2.88
2fd5A01 88.53 Probable transcriptional regulatorPseudomonas aeruginosa 1.10.10.60 48 18 75 2.25 2.97
3c2bA01 88.44 Agrobacterium tumefaciens str. C58Transcriptional regulator, TetR family 1.10.10.60 51 23 82 1.64 1.99
2id6A01 88.34 Thermotoga maritimaTranscriptional regulator, TetR family 1.10.10.60 46 36 72 2.49 3.43
1t56A01 87.52 TRANSCRIPTIONAL REGULATORY REPRESSOR PROTEIN (TETR-FAMILY) ETHRMycobacterium tuberculosis 1.10.10.60 46 23 72 1.21 1.67
2fq4A01 87.45 Transcriptional regulator, TetR familyBacillus cereus ATCC 14579 1.10.10.60 47 19 74 1.42 1.91
3f0cA01 86.78 Cytophaga hutchinsonii ATCC 33406Transcriptional regulator 1.10.10.60 47 40 75 1.54 2.03
2ibdA01 86.40 Rhodococcus jostii RHA1Possible transcriptional regulator 1.10.10.60 45 28 70 1.54 2.17
3ccyA01 85.85 Bordetella parapertussisPutative TetR-family transcriptional regulator 1.10.10.60 44 25 69 1.42 2.05
2raeA01 85.45 Rhodococcus jostii RHA1Transcriptional regulator, AcrR family protein 1.10.10.60 43 16 67 1.29 1.90
3bqyA01 83.57 Putative transcriptional regulatorStreptomyces coelicolor 1.10.10.60 48 31 74 2.89 3.90
1sauA02 81.74 Archaeoglobus fulgidusSulfite reductase, desulfoviridin-type subunit gamma (DsvC) 1.10.10.370 70 16 75 2.46 3.25
1w1wE00 80.05 Nuclear mitotic cohesin complexProtein acetylationChromatin bindingCohesin complex subunit SCC1Establishment of mitotic sister chromatid cohesion 1.10.10.580 70 11 71 3.24 4.54
1b8iB00 80.02 Oenocyte developmentLeg disc proximal/distal pattern formationTranscription factor complexBrain developmentDrosophila melanogaster 1.10.10.60 58 10 80 3.52 4.36
2hxoA01 79.80 Streptomyces coelicolorPutative TetR-family transcriptional regulator 1.10.10.60 63 16 80 3.39 4.19
1zk8A01 79.69 Transcriptional regulator, TetR familyBacillus cereus ATCC 14579 1.10.10.60 46 13 70 2.84 4.00
1mh3A03 78.72 Transcription corepressor activityMeiosis - yeastNucleusRegulation of transcription, mating-type specificMating-type protein A1 1.10.10.60 51 9 70 3.16 4.45
1jusD01 77.56 HTH-type transcriptional regulator qacRStaphylococcus aureus 1.10.10.60 49 16 43 0.68 1.56
2dmqA01 77.41 LIM/homeobox protein Lhx9Homo sapiens 1.10.10.60 57 7 69 3.23 4.66
2f48A03 76.73 Fructose and mannose metabolismPyrophosphate--fructose-6-phosphate 1-phosphotransferase [EC:2.7.1.90]Borrelia burgdorferiPyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta subunit (PfpB) 1.10.10.480 75 4 65 3.05 4.67
1bl0A01 76.22 Multiple antibiotic resistance protein marAAraC family transcriptional regulator, multiple antibiotic resistance protein MarAEscherichia coli K-12 1.10.10.60 56 3 79 3.31 4.19
2pz9A00 71.72 Streptomyces coelicolorPutative regulatory protein 1.10.357.10 177 25 28 0.61 2.12
3bhqA00 71.65 Mesorhizobium lotiTranscriptional regulator 1.10.357.10 183 25 30 1.37 4.48
3bniB00 71.46 Streptomyces coelicolorPutative TetR-family transcriptional regulator 1.10.357.10 171 17 29 1.10 3.69
2q24A00 71.44 Streptomyces coelicolorPutative tetR family transcriptional regulator 1.10.357.10 163 25 30 0.96 3.13
3cjdA00 70.75 Jannaschia sp. CCS1Transcriptional regulator, TetR family 1.10.357.10 175 24 30 1.19 3.93
2g3bA00 70.73 Rhodococcus jostii RHA1Possible transcriptional regulator, TetR family protein 1.10.357.10 184 16 27 0.89 3.21
2hkuB00 70.70 Rhodococcus jostii RHA1Possible transcriptional regulator, TetR family protein 1.10.357.10 182 29 27 0.69 2.51
2g7sA00 69.96 Agrobacterium tumefaciens str. C58Transcriptional regulator, TetR family 1.10.357.10 187 19 28 1.10 3.81
3bruB00 69.42 Regulatory protein TetR familyRhodobacter sphaeroides 2.4.1 1.10.357.10 186 24 27 1.33 4.76
2fbqA00 68.71 Pseudomonas aeruginosaTranscriptional regulator PsrA 1.10.357.10 213 30 25 0.83 3.27
3bjbD00 68.36 Rhodococcus jostii RHA1Probable transcriptional regulator, TetR family protein 1.10.357.10 168 22 29 1.40 4.80
2genA00 68.10 Probable transcriptional regulatorPseudomonas aeruginosa 1.10.357.10 186 25 26 1.21 4.59
2qibB00 68.02 Streptomyces coelicolorPutative tetR-family transcriptional regulator 1.10.357.10 204 25 24 1.04 4.24
[1]
Displaying entries 1 to 36 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1t33B01
TTKGEQAKSQLIAAALAQFGEYGLHATTRDIAALAGQNIAAITYYFGSKEDLYLAC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1t33B01
MNIPTTTTKGEQAKSQLIAAALAQFGEYGLHATTRDIAALAGQNIAAITYYFGSKEDLYLAC
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 15 Dec 2006 11:36

Assigning to "1.10.10.60" based on similarity with "1t33A01"

Flow stage update by auto on 15 Dec 2006 11:35

No in_process hits for Domain "1t33B01" ready to be processed

Update comment by auto on 15 Dec 2006 07:34

Domain "1t33B01" hits Domain "1t33A01" (100% over 100%) which is currently in process

Flow stage update by auto on 15 Dec 2006 07:33

Domain "1t33B01" hits Domain "1t33A01" (100% over 100%) which is currently in process

Flow stage update by auto on 15 Dec 2006 07:33

NW result present for Domain "1t33B01"

Flow stage update by auto on 14 Dec 2006 15:49

All required files are present for Domain "1t33B01"

Flow stage update by auto on 13 Dec 2006 19:36

Beginning processing for Domain "1t33B01"

Insertion by auto on 13 Dec 2006 19:24

Final ChopClose added based on similarity with "1t33A"