CATH Domain: 1sz2B01 XML data for domain: 1sz2B01

Molscript image for 1sz2B01
1sz2B01
PDB coordinates for domain 1sz2B01

PDB 1sz2, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.25
3.30.420.40.25.1
3.30.420.40.25.1.1
3.30.420.40.25.1.1.1
3.30.420.40.25.1.1.1.1

[top]
Segment boundaries for domain 1sz2B01

Chopping figure for domain 1sz2B01
DomainStart PDB ResidueStop PDB Residue
1sz2B01 2 99
1sz2B01 300 321
1sz2B02 100 299

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.420.40.25.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1huxA01 80.24 Activator of (R)-2-hydroxyglutaryl-CoA dehydrataseAcidaminococcus fermentans DSM 20731 3.30.420.40 119 11 80 3.39 4.20
2gupA01 79.87 ROK family proteinStreptococcus pneumoniae 3.30.420.40 96 13 73 2.96 4.01
3epqA01 76.87 3.30.420.40 91 10 69 2.75 3.96
1e4fT04 73.76 Thermotoga maritimaCell division protein FtsA, putativeCell division protein FtsA 3.30.420.40 89 5 66 2.76 4.12
2qxlA03 73.75 Adenyl-nucleotide exchange factor activityHeat shock protein homolog SSE1Protein refoldingHeat shock protein 110kDaCytoplasm 3.30.420.40 93 8 66 3.29 4.91
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1sz2B01
TKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGCIAIACPITGDWVATNHTWAFS
IAEKKNLGFSHLEIINVHDNPGLLGSGAHLRQTLGHIL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1sz2B01
XGSSHHHHHHGSTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGCIAIACPITG
DWVAXTNHTWAFSIAEXKKNLGFSHLEIINVHDNPGLLGSGAHLRQTLGHIL
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:10

Assigning to "3.30.420.40" based on similarity with "1sz2A01" (NWSI: 97.7272727272727, NWO: 100, SPS: 96.77, SPO: 99, RMSD: 0.42)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1sz2B01"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1sz2B01"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1sz2B01"

Insertion by auto on 09 Mar 2006 06:06

Final ChopClose added based on similarity with "1q18A" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 93.94, SI: 98.1927710843374, SO: 100]