CATH Domain: 1sv0D00 XML data for domain: 1sv0D00

Molscript image for 1sv0D00
1sv0D00
PDB coordinates for domain 1sv0D00

PDB 1sv0, Chain D, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.50 Transcription Factor, Ets-1 Gene3D
1.10.150.50.6
1.10.150.50.6.1
1.10.150.50.6.1.1
1.10.150.50.6.1.1.1
1.10.150.50.6.1.1.1.1

[top]
Segment boundaries for domain 1sv0D00

Chopping figure for domain 1sv0D00
DomainStart PDB ResidueStop PDB Residue
1sv0D00 95 175

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 1.10.150.50.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1x66A01 87.07 Sequence-specific DNA binding transcription factor activityHemostasisOrgan morphogenesisHomo sapiensFriend leukemia integration 1 transcription factor 1.10.150.50 70 24 83 2.17 2.58
1sxdA00 85.04 Mus musculusGA-binding protein alpha chainIn utero embryonic developmentNucleusNegative regulation of transcription from RNA polymerase II promoter 1.10.150.50 91 17 85 2.42 2.82
1z1vA00 83.79 Protein kinase regulator activitySAM domain bindingProtein STE50Signal transduction involved in filamentous growthPheromone-dependent signal transduction involved in conjugation with cellular fusion 1.10.150.50 70 17 79 2.05 2.59
1x9xA00 79.10 MAPK signaling pathway - yeastSAM domain bindingIdentical protein bindingInvasive growth in response to glucose limitationActivation of MAPKK activity 1.10.150.50 62 8 67 2.52 3.71
3kkaD00 78.57 Integral to plasma membraneEphrin type-A receptor 2Protein bindingSignal transductionEph receptor A2 [EC:2.7.10.1] 1.10.150.50 68 11 80 3.66 4.56
1dxsA00 77.70 DNA damage response, signal transduction resulting in induction of apoptosisTranscription factor bindingProtein bindingPositive regulation of transcription, DNA-dependentMismatch repair 1.10.150.50 57 5 67 3.09 4.55
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1sv0D00
LGSDGLPLDPRDWTRADVWKWLINMAVSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVPVGGKMLYRDFRVRLARAMS
R
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1sv0D00
PLGSDGLPLDPRDWTRADVWKWLINMAVSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVPVGGKMLYRDFRVRLARAM
SR
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:05

Assigning to "1.10.150.50" based on similarity with "1sv0C00" (NWSI: 100, NWO: 100, SPS: 96.77, SPO: 98, RMSD: 0.56)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1sv0D00"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1sv0D00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1sv0D00"

Insertion by auto on 09 Mar 2006 05:17

Final ChopClose added based on similarity with "1sv0C" [LEE: 0, LME: 0, MR: 1, LG: 1, SS: 96.77, SI: 100, SO: 100]