CATH Domain: 1stuA00 XML data for domain: 1stuA00

Molscript image for 1stuA00
1stuA00
PDB coordinates for domain 1stuA00

PDB 1stu, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.160 Double Stranded RNA Binding Domain
3.30.160.20 Gene3D
3.30.160.20.6
3.30.160.20.6.1
3.30.160.20.6.1.1
3.30.160.20.6.1.1.1
3.30.160.20.6.1.1.1.1

[top]
Segment boundaries for domain 1stuA00

Chopping figure for domain 1stuA00
DomainStart PDB ResidueStop PDB Residue
1stuA00 1 68

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.30.160.20.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1x49A01 85.88 TranslationInterferon-induced, double-stranded RNA-activated protein kinaseProtein bindingEndoplasmic reticulum unfolded protein responseMus musculus 3.30.160.20 70 17 95 2.63 2.75
1qu6A02 85.64 Eukaryotic translation initiation factor 2alpha kinase activityProtein phosphatase type 2A regulator activityInterferon-induced, double-stranded RNA-activated protein kinaseProtein bindingNegative regulation of osteoblast proliferation 3.30.160.20 76 22 88 2.62 2.97
2b7vA00 83.95 Rattus norvegicusNucleolusDouble-stranded RNA-specific editase 1MRNA modificationNucleoplasm 3.30.160.20 71 29 90 2.86 3.17
1l4sA01 76.45 Ribosome-associated inhibitor ARibosome-associated inhibitor ACytosolic small ribosomal subunitEscherichia coli K-12 3.30.160.100 91 14 69 3.21 4.64
2rqlA00 76.10 Protein bindingPutative sigma-54 modulation proteinEscherichia coli K-12Probable sigma(54) modulation protein 3.30.160.100 95 13 65 2.96 4.54
3bidA01 74.78 Neisseria meningitidis serogroup BUPF0339 protein NMB1088 3.30.160.160 46 6 60 2.50 4.15
2drpA01 69.70 Brain morphogenesisDorsal appendage formationChromatin bindingDrosophila melanogasterPeripheral nervous system development 3.30.160.60 34 5 42 1.99 4.67
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1stuA00
PISQVHEIGIKRNMTVHFKVLREEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1stuA00
PISQVHEIGIKRNMTVHFKVLREEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKL
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1stu000" to "1stuA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:01

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:01

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"