Domain assigned by auto on 15 Aug 2007 01:46
Assigning to "1.10.3130.10" based on similarity with "1ssqD01"
CATH Domain: 1ssqA01
1ssqA01
PDB 1ssq, Chain A, Domain 1
Segment boundaries for domain 1ssqA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ssqA01 | 1 | 138 |
| 1ssqA02 | 139 | 241 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|1ssqA01 MNLDVWQHIRQEAKELAENEPMLASFFHSTILKHQNLGGALSYLLANKLANPIMPAISLREIIEEAYQSNPSIIDCAACD IQAVRHRDPAVELWSTPLLYLKGFHAIQSYRITHYLWNQNRKSLALYLQNQISVAFDV
Domain History Events (9)
Flow stage update by auto on 15 Aug 2007 01:23
No in_process hits for Domain "1ssqA01" ready to be processed
Update comment by auto on 14 Aug 2007 23:56
Domain "1ssqA01" hits Domain "1sstA01" (99.2753623188406% over 100%) which is currently in process
Update comment by auto on 14 Aug 2007 22:45
Domain "1ssqA01" hits Domain "1ssqD01" (100% over 100%) which is currently in process
Flow stage update by auto on 18 Jul 2007 22:35
Domain "1ssqA01" hits Domain "1ssmE01" (97.1014492753623% over 100%) which is currently in process
Flow stage update by auto on 18 Jul 2007 22:35
NW result present for Domain "1ssqA01"
Flow stage update by auto on 16 Jul 2007 22:37
All required files are present for Domain "1ssqA01"
Flow stage update by auto on 15 Jul 2007 07:07
Beginning processing for Domain "1ssqA01"
Insertion by auto on 15 Jul 2007 06:11
Final ChopClose added based on similarity with "1sstA"
