CATH Domain: 1ss4A00 XML data for domain: 1ss4A00

Molscript image for 1ss4A00
1ss4A00
PDB coordinates for domain 1ss4A00

PDB 1ss4, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.180 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1
3.10.180.10 2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 Gene3D
3.10.180.10.11
3.10.180.10.11.1
3.10.180.10.11.1.1
3.10.180.10.11.1.1.1
3.10.180.10.11.1.1.1.1

Segment boundaries for domain 1ss4A00

Chopping figure for domain 1ss4A00
DomainStart PDB ResidueStop PDB Residue
1ss4A00 0 148

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.10.180.10.11.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2rk0A01 81.54 Glyoxalase/bleomycin resistance protein/dioxygenaseFrankia sp. EAN1pec 3.10.180.10 119 21 78 2.49 3.18
2p25A01 80.38 Glyoxylase I family proteinGlyoxylase family proteinEnterococcus faecalis 3.10.180.10 118 17 80 3.24 4.03
2rbbA00 80.15 Burkholderia phytofirmans PsJNGlyoxalase/bleomycin resistance protein/dioxygenase 3.10.180.10 126 13 81 3.23 3.98
3ct8A00 78.81 BH2160 proteinBacillus halodurans 3.10.180.10 131 12 83 4.10 4.93
2qntA01 78.15 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 3.10.180.10 109 13 72 3.14 4.36
2qqzA01 78.06 Bacillus anthracisGlyoxalase family protein 3.10.180.10 113 16 76 3.40 4.42
3ghjA00 78.01 Uncultured bacteriumPutative integron gene cassette protein 3.10.180.10 114 10 73 3.30 4.49
Displaying entries 1 to 7 (page 1 of 1)


Domain ATOM Sequence

>pdb|1ss4A00
AAKNKLLRDNVSIVVESLDNAISFFEEIGLNLEGRANVEGEWAGRVTGLGSQCVEIAVTPDGHSRIELSRFLTPPTIADH
RTAPVNALGYLRVFTVEDIDEVSRLTKHGAELVGEVVQYENSYRLCYIRGVEGILIGLAEELG    

Domain COMBS Sequence

>pdb|1ss4A00
SNAXAKNKLLRXDNVSIVVESLDNAISFFEEIGLNLEGRANVEGEWAGRVTGLGSQCVEIAXXVTPDGHSRIELSRFLTP
PTIADHRTAPVNALGYLRVXFTVEDIDEXVSRLTKHGAELVGEVVQYENSYRLCYIRGVEGILIGLAEELGNK    

Domain History Events (12)

Domain assigned by auto on 11 Feb 2008 14:13

Assigning to "3.10.180.10" based on similarity with "1ss4B00"

Flow stage update by auto on 11 Feb 2008 14:04

No in_process hits for Domain "1ss4A00" ready to be processed

Update comment by auto on 03 Sep 2007 20:09

Domain "1ss4A00" hits Domain "1ss4B00" (96.078431372549% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:15

Domain "1ss4A00" hits Domain "1ss4B00" (96.078431372549% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:35

Domain "1ss4A00" hits Domain "1ss4B00" (96.078431372549% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:18

Domain "1ss4A00" hits Domain "1ss4B00" (96.078431372549% over 100%) which is currently in process

Update comment by auto on 27 Jun 2007 22:02

Domain "1ss4A00" hits Domain "1ss4B00" (96.078431372549% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:10

Domain "1ss4A00" hits Domain "1ss4B00" (96.078431372549% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "1ss4A00"

Flow stage update by auto on 14 Mar 2007 15:02

All required files are present for Domain "1ss4A00"

Flow stage update by auto on 14 Mar 2007 15:00

Beginning processing for Domain "1ss4A00"

Insertion by auto on 25 Oct 2006 13:22

Final ChopClose added based on similarity with "1ss4B"