CATH Domain: 1srsA01 XML data for domain: 1srsA01

Molscript image for 1srsA01
1srsA01
PDB coordinates for domain 1srsA01

PDB 1srs, Chain A, Domain 1

This domain is in the HOLDING_PEN flow stage and therefore has not yet been assigned to a homologous superfamily in CATH. You can view the domain history to see more information.

[top]
Segment boundaries for domain 1srsA01

Chopping figure for domain 1srsA01
DomainStart PDB ResidueStop PDB Residue
1srsA01 153 223

Structural Neighbourhood ( entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1srsA01
NKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1srsA01
NKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPD
BLAST against CATH

[top]
Domain History Events (12)

Update comment by auto on 14 Oct 2010 11:34

Domain "1srsA01" hits Domain "1mnmB01" (70.4225352112676% over 97.2602739726027%) which is currently in process

Update comment by auto on 13 Oct 2010 17:47

Domain "1srsA01" hits Domain "1mnmB01" (70.4225352112676% over 97.2602739726027%) which is currently in process

Update comment by auto on 04 Aug 2010 02:01

Domain "1srsA01" hits Domain "1mnmB01" (70.4225352112676% over 97.2602739726027%) which is currently in process

Update comment by auto on 23 Jul 2008 18:01

Domain "1srsA01" hits Domain "1mnmB01" (70.4225352112676% over 97.2602739726027%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "1srsA01" hits Domain "1mnmB01" (70.4225352112676% over 97.2602739726027%) which is currently in process

Update comment by auto on 03 Sep 2007 11:17

Domain "1srsA01" hits Domain "1mnmB01" (70.4225352112676% over 97.2602739726027%) which is currently in process

Update comment by auto on 02 Sep 2007 18:08

Domain "1srsA01" hits Domain "1mnmB01" (70.4225352112676% over 97.2602739726027%) which is currently in process

Flow stage update by auto on 02 Sep 2007 18:07

Domain "1srsA01" hits Domain "1mnmB01" (70.4225352112676% over 97.2602739726027%) which is currently in process

Flow stage update by auto on 02 Sep 2007 18:07

NW result present for Domain "1srsA01"

Flow stage update by auto on 01 Sep 2007 14:04

All required files are present for Domain "1srsA01"

Flow stage update by auto on 31 Aug 2007 19:48

Beginning processing for Domain "1srsA01"

Insertion by cuff on 31 Aug 2007 15:25

nice chopping