CATH Domain: 1siqA01 XML data for domain: 1siqA01

Molscript image for 1siqA01
1siqA01
PDB coordinates for domain 1siqA01

PDB 1siq, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.540 Butyryl-Coa Dehydrogenase, subunit A; domain 1
1.10.540.10 Butyryl-Coa Dehydrogenase, subunit A, domain 1 Gene3D
1.10.540.10.8
1.10.540.10.8.1
1.10.540.10.8.1.1
1.10.540.10.8.1.1.1
1.10.540.10.8.1.1.1.1

[top]
Segment boundaries for domain 1siqA01

Chopping figure for domain 1siqA01
DomainStart PDB ResidueStop PDB Residue
1siqA01 3 130
1siqA02 131 237
1siqA03 238 392

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.10.540.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1bucA01 89.42 Acyl-CoA dehydrogenase, short-chain specificMegasphaera elsdenii 1.10.540.10 123 26 92 2.14 2.30
1ukwA01 87.80 Geraniol degradationThermus thermophilus HB27[EC:1.3.99.-]Putative acyl-CoA dehydrogenase1- and 2-Methylnaphthalene degradation 1.10.540.10 116 21 89 2.36 2.63
1r2jA01 85.15 Streptomyces hygroscopicus subsp. ascomyceticusFkbI 1.10.540.10 103 20 79 1.46 1.83
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1siqA01
EFDWQDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGVSSVAYGLL
ARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1siqA01
EFDWQDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGVSSVAYGLL
ARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELL
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:47

Cut based on decision in database "DomChop" on "cathdb"