CATH Domain: 1sh1A00 XML data for domain: 1sh1A00

Molscript image for 1sh1A00
1sh1A00
PDB coordinates for domain 1sh1A00

PDB 1sh1, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.20 Anthopleurin-A
2.20.20.10 Anthopleurin-A Gene3D
2.20.20.10.6
2.20.20.10.6.1
2.20.20.10.6.1.1
2.20.20.10.6.1.1.1
2.20.20.10.6.1.1.1.1

[top]
Segment boundaries for domain 1sh1A00

Chopping figure for domain 1sh1A00
DomainStart PDB ResidueStop PDB Residue
1sh1A00 1 48

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.20.20.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1fd3A00 81.64 Homo sapiensBeta-defensin 2Immune responseG-protein coupled receptor protein signaling pathwayChemotaxis 3.10.360.10 41 9 68 2.21 3.21
1kj6A00 80.39 Positive regulation of biosynthetic process of antibacterial peptides active against Gram-positive bacteriaBeta-defensin 103Homo sapiens 3.10.360.10 45 24 77 3.38 4.38
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1sh1A00
AACKCDDEGPDIRTAPLTGTVDLGSCNAGWEKCASYYTIIADCCRKKK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1sh1A00
AACKCDDEGPDIRTAPLTGTVDLGSCNAGWEKCASYYTIIADCCRKKK
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1sh1000" to "1sh1A00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:46

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"