Set cath from cathlist by auto on 05 Mar 2006 18:20
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1sg6A01 | 4 | 182 |
| 1sg6A02 | 183 | 391 |
There are 2 matching structural neighberhood comparisons for CATH ID 1.20.1090.10.3.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1ujnA02 | 83.93 | 1.20.1090.10 | 168 | 25 | 80 | 2.43 | 3.01 | |
![]() |
1oj7A02 | 78.76 | 1.20.1090.10 | 204 | 13 | 77 | 3.31 | 4.25 |
>pdb|1sg6A02 LPVREFINGMAEVIKTAAISSEEEFTALEENAETILKAVRREVTPGEHRFEGTEEILKARILASARHKAYVVSAGLRNLL NWGHSIGHAIEAILTPQILHGECVAIGMVKEAELARHLGILKGVAVSRIVKCLAAYGLPTSLKDARIRKLTAGKHCSVDQ LMFNMALDKKIVLLSAIGTPYETRASVVANEDIRVVL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"