CATH Domain: 1s5aA00 XML data for domain: 1s5aA00

Molscript image for 1s5aA00
1s5aA00
PDB coordinates for domain 1s5aA00

PDB 1s5a, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.8
3.10.450.50.8.1
3.10.450.50.8.1.1
3.10.450.50.8.1.1.1
3.10.450.50.8.1.1.1.1

Segment boundaries for domain 1s5aA00

Chopping figure for domain 1s5aA00
DomainStart PDB ResidueStop PDB Residue
1s5aA00 4 141

Structural Neighbourhood (18 entries)

There are 18 matching structural neighberhood comparisons for CATH ID 3.10.450.50.8.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 18 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ohpA00 85.54 Comamonas testosteroniSteroid Delta-isomerase 3.10.450.50 125 18 88 2.71 3.07
1tuhA00 84.85 Uncultured bacteriumPutative uncharacterized protein 3.10.450.50 131 23 93 2.49 2.67
3dm8A00 84.83 Rhodopseudomonas palustrisPutative uncharacterized protein 3.10.450.50 131 12 93 2.71 2.90
1gy6A00 82.90 Nuclear transport factor 2Nuclear poreHomo sapiensProtein bindingCytosol 3.10.450.50 125 4 83 3.03 3.62
3cnxA00 82.89 Streptomyces avermitilisPutative uncharacterized protein 3.10.450.50 135 9 83 2.60 3.11
3b8lA01 82.84 Novosphingobium aromaticivorans DSM 12444Putative uncharacterized protein 3.10.450.50 135 12 91 2.55 2.80
1jkgA00 82.40 CytoplasmNuclear poreHomo sapiensNTF2-related export protein 1 3.10.450.50 139 6 79 2.50 3.16
1tp6A00 81.87 Pseudomonas aeruginosaPutative uncharacterized protein 3.10.450.50 126 6 79 2.37 2.99
3b7cA00 80.82 Shewanella oneidensisPutative uncharacterized protein 3.10.450.50 115 8 77 2.52 3.27
2rgqB00 80.49 3.10.450.50 124 7 85 3.32 3.90
3blzA00 79.57 Shewanella baltica OS155Putative uncharacterized protein 3.10.450.50 123 8 80 2.82 3.49
2r4iA00 79.48 Cytophaga hutchinsonii ATCC 33406Putative uncharacterized protein 3.10.450.50 113 7 80 3.36 4.20
2owpA00 77.90 Burkholderia xenovorans LB400Putative uncharacterized protein 3.10.450.50 124 10 78 3.82 4.87
1of5B00 77.11 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 7 82 3.82 4.65
1q42A00 77.00 MRNA transport regulator MTR2Candida albicans 3.10.450.50 159 8 72 3.29 4.55
3bb9B00 76.49 Putative orphan proteinShewanella frigidimarina NCIMB 400 3.10.450.50 120 13 81 3.87 4.75
2jq5A00 76.30 SEC-C motifSEC-C motif domain proteinRhodopseudomonas palustris 3.10.450.50 128 9 75 3.36 4.45
2ux0B00 75.29 Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex 3.10.450.50 136 7 75 3.78 4.99
Displaying entries 1 to 18 (page 1 of 1)


Domain ATOM Sequence

>pdb|1s5aA00
NEFEKACETLRKFAYLEKDKSWTELWDENAVFEFPYAPEGSPKRIEGKAAIYDYIKDYPKQIHLSSFTAPTVYRSADSNT
VIAEFQCDGHVIETGLPYRQSYISVIETRDGRIVRYRDYWNPLVVKEAFGGSFLQ    

Domain COMBS Sequence

>pdb|1s5aA00
SNAXLXNEFEKACETLRKFXAYXLEKDXKSWTELWDENAVFEFPYAPEGSPKRIEGKAAIYDYIKDYPKQIHLSSFTAPT
VYRSADSNTVIAEFQCDGHVIETGLPYRQSYISVIETRDGRIVRYRDYWNPLVVKEAFGGSFLQTEESGK    

Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:44

Cut based on decision in database "DomChop" on "cathdb"