CATH Domain: 1s57B00 XML data for domain: 1s57B00

Molscript image for 1s57B00
1s57B00
PDB coordinates for domain 1s57B00

PDB 1s57, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.141 Gene3D
3.30.70.141.1
3.30.70.141.1.1
3.30.70.141.1.1.1
3.30.70.141.1.1.1.1
3.30.70.141.1.1.1.1.1

[top]
Segment boundaries for domain 1s57B00

Chopping figure for domain 1s57B00
DomainStart PDB ResidueStop PDB Residue
1s57B00 83 231

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.70.141.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3b6bC00 90.87 Nucleoside diphosphate kinaseAcanthamoeba polyphaga mimivirus 3.30.70.141 132 39 87 1.29 1.48
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1s57B00
VEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEGVGV
VASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1s57B00
SMEDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWE
GVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 15 Aug 2007 02:42

Assigning to "3.30.70.141" based on similarity with "1s59B00"

Flow stage update by auto on 15 Aug 2007 02:33

No in_process hits for Domain "1s57B00" ready to be processed

Update comment by auto on 15 Aug 2007 01:22

Domain "1s57B00" hits Domain "1s59B00" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 23:55

Domain "1s57B00" hits Domain "1s59E00" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:45

Domain "1s57B00" hits Domain "1s59A00" (100% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:10

Domain "1s57B00" hits Domain "1s57F00" (100% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "1s57B00"

Flow stage update by auto on 14 Mar 2007 15:02

All required files are present for Domain "1s57B00"

Flow stage update by auto on 14 Mar 2007 15:00

Beginning processing for Domain "1s57B00"

Insertion by auto on 29 Nov 2006 09:18

Final ChopClose added based on similarity with "1s57A"