CATH Domain: 1s2oA02 XML data for domain: 1s2oA02

Molscript image for 1s2oA02
1s2oA02
PDB coordinates for domain 1s2oA02

PDB 1s2o, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1070 Hypothetical Protein Ta0175; Chain: A, domain 2
3.90.1070.10 Gene3D
3.90.1070.10.1
3.90.1070.10.1.1
3.90.1070.10.1.1.1
3.90.1070.10.1.1.1.1
3.90.1070.10.1.1.1.1.1

[top]
Segment boundaries for domain 1s2oA02

Chopping figure for domain 1s2oA02
DomainStart PDB ResidueStop PDB Residue
1s2oA01 1 88
1s2oA01 160 244
1s2oA02 89 159

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.90.1070.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wr8A02 84.68 Pyrococcus horikoshiiPhosphoglycolate phosphatase 3.90.1070.10 69 8 92 2.68 2.88
2kt2A00 81.02 Mercuric reductasePseudomonas aeruginosaMercuric reductase [EC:1.16.1.1] 3.30.70.100 69 7 78 3.36 4.26
1u02A02 80.62 Trehalose-6-phosphate phosphatase related proteinThermoplasma acidophilum 3.30.70.1020 73 11 90 3.94 4.36
1vi7A02 80.26 IMPACT family member yigZProtein bindingEscherichia coli K-12 3.30.70.240 71 9 83 3.57 4.30
1uv7A00 79.69 Vibrio choleraeGeneral secretion pathway protein M 3.30.1360.100 74 11 87 3.42 3.89
3gygA02 78.38 Bacillus subtilisNTD biosynthesis operon putative hydrolase ntdB 3.30.70.1410 86 18 76 3.13 4.08
3cjkB00 78.18 Cu2+-exporting ATPase [EC:3.6.3.4]Copper-dependent protein bindingCopper-transporting ATPase 1Cellular copper ion homeostasisTrans-Golgi network 3.30.70.100 75 8 81 3.78 4.65
1mwyA00 78.02 Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 3.6.3.5]Detoxification of zinc ionLead, cadmium, zinc and mercury-transporting ATPaseEscherichia coli K-12Response to cadmium ion 3.30.70.100 73 7 73 3.37 4.56
1xviA02 76.56 Fructose and mannose metabolismMannosyl-3-phosphoglycerate phosphatase [EC:3.1.3.70]Putative mannosyl-3-phosphoglycerate phosphataseProtein bindingEscherichia coli K-12 3.30.980.20 91 9 71 3.15 4.41
1u0sA00 76.37 Thermotoga maritimaBacterial chemotaxisTwo-component systemTwo-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]Protein binding 3.30.70.1110 86 7 60 2.77 4.58
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1s2oA02
WQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1s2oA02
WQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQ
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:43

Cut based on decision in database "DomChop" on "cathdb"