CATH Domain: 1s1fA00 XML data for domain: 1s1fA00

Molscript image for 1s1fA00
1s1fA00
PDB coordinates for domain 1s1fA00

PDB 1s1f, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.630 Cytochrome p450
1.10.630.10 Cytochrome p450 Gene3D
1.10.630.10.7
1.10.630.10.7.1
1.10.630.10.7.1.1
1.10.630.10.7.1.1.1
1.10.630.10.7.1.1.1.1

[top]
Segment boundaries for domain 1s1fA00

Chopping figure for domain 1s1fA00
DomainStart PDB ResidueStop PDB Residue
1s1fA00 8 406

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 1.10.630.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1cptA00 84.26 Pseudomonas sp.Cytochrome P450-terp 1.10.630.10 412 24 94 3.19 3.37
2z3tA00 83.79 Cytochrome P450Streptomyces sp. TP-A0274 1.10.630.10 385 30 93 3.89 4.17
1odoA00 83.77 Streptomyces coelicolorPutative cytochrome P450 1.10.630.10 395 27 94 2.98 3.14
1lfkA00 83.68 Amycolatopsis orientalisCytochrome P450 165B3 1.10.630.10 375 32 93 3.20 3.43
1t2bA00 83.49 Citrobacter braakiiP450cin 1.10.630.10 397 20 94 3.28 3.45
1q5dA00 83.18 Epothilone biosynthetic processCytochrome P450 167A1Sorangium cellulosum 1.10.630.10 401 24 94 3.18 3.37
1izoA00 79.88 Bacillus subtilisLimonene and pinene degradationNaphthalene and anthracene degradationGamma-Hexachlorocyclohexane degradationCytochrome P450 152A1 1.10.630.10 411 13 90 3.12 3.44
1n97A00 79.51 Thermus thermophilus HB27Cytochrome P450 1.10.630.10 385 17 87 3.42 3.89
3czhA00 76.94 Vitamin D 25-hydroxylaseHomo sapiensCytochrome P450, family 2, subfamily R 1.10.630.10 465 14 81 3.65 4.48
1tqnA00 76.86 Vitamin D 24-hydroxylase activityCell surfaceSteroid bindingSteroid hormone biosynthesisMetabolic pathways 1.10.630.10 468 17 79 3.79 4.74
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1s1fA00
QAVPPVRDWPAVDLPGSDFDPVLTELMREGPVTRISLPNGEGWAWLVTRHDDVRLVTNDPRFGREAVMDRQVTRLAPHFI
PARGAVGFLDPPDHTRLRRSVAAAFTARGVERVRERSRGMLDELVDAMLRAGPPADLTEAVLSPFPIAVICELMGVPATD
RHSMHTWTQLILSSSHGAEVSERAKNEMNAYFSDLIGLRSDSAGEDVTSLLGAAVGRDEITLSEAVGLAVLLQIGGEAVT
NNSGQMFHLLLSRPELAERLRSEPEIRPRAIDELLRWIPHRNAVGLSRIALEDVEIKGVRIRAGDAVYVSYLAANRDPEV
FPDPDRIDFERNPHVSFGFGPHYCPGGMLARLESELLVDAVLDRVPGLKLAVAPEDVPFKKGALIRGPEALPVTWHA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1s1fA00
MTEETISQAVPPVRDWPAVDLPGSDFDPVLTELMREGPVTRISLPNGEGWAWLVTRHDDVRLVTNDPRFGREAVMDRQVT
RLAPHFIPARGAVGFLDPPDHTRLRRSVAAAFTARGVERVRERSRGMLDELVDAMLRAGPPADLTEAVLSPFPIAVICEL
MGVPATDRHSMHTWTQLILSSSHGAEVSERAKNEMNAYFSDLIGLRSDSAGEDVTSLLGAAVGRDEITLSEAVGLAVLLQ
IGGEAVTNNSGQMFHLLLSRPELAERLRSEPEIRPRAIDELLRWIPHRNAVGLSRIALEDVEIKGVRIRAGDAVYVSYLA
ANRDPEVFPDPDRIDFERSPNPHVSFGFGPHYCPGGMLARLESELLVDAVLDRVPGLKLAVAPEDVPFKKGALIRGPEAL
PVTWHA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 20 Jul 2007 16:01

Assigning to "1.10.630.10" based on similarity with "2c7xA00"

Flow stage update by auto on 18 Jul 2007 18:50

No in_process hits for Domain "1s1fA00" ready to be processed

Flow stage update by auto on 18 Jul 2007 18:50

NW result present for Domain "1s1fA00"

Flow stage update by auto on 14 Jul 2007 06:01

All required files are present for Domain "1s1fA00"

Flow stage update by auto on 13 Jul 2007 18:42

Beginning processing for Domain "1s1fA00"

Insertion by auto on 12 Jul 2007 22:45

Final ChopClose added based on similarity with "2bvjB"