CATH Domain: 1s16A01 XML data for domain: 1s16A01

Molscript image for 1s16A01
1s16A01
PDB coordinates for domain 1s16A01

PDB 1s16, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.565 Heat Shock Protein 90
3.30.565.10 Gene3D
3.30.565.10.8
3.30.565.10.8.1
3.30.565.10.8.1.1
3.30.565.10.8.1.1.1
3.30.565.10.8.1.1.1.3

[top]
Segment boundaries for domain 1s16A01

Chopping figure for domain 1s16A01
DomainStart PDB ResidueStop PDB Residue
1s16A01 1004 1215
1s16A02 1216 1383

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.565.10.8.1.1.1.3 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1s14B00 96.07 CytoplasmPlasmid partitioningTopoisomerase IV subunit B [EC:5.99.1.-]DNA topoisomerase 4 subunit BSister chromatid cohesion 3.30.565.10 178 98 97 0.48 0.49
1pvgA01 82.32 Reciprocal meiotic recombinationDNA topoisomerase 2Regulation of mitotic recombinationDNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 3.30.565.10 238 21 72 2.16 2.97
2o1wA01 80.56 Canis lupus familiarisPathways in cancerProstate cancerHeat shock protein 90kDa betaNOD-like receptor signaling pathway 3.30.565.10 172 12 83 3.81 4.54
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1s16A01
TYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEG
VPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGT
SVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1s16A01
MTQTYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHP
EEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRN
TGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCY
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:49

Assigning to "3.30.565.10" based on similarity with "1kijB01" (NWSI: 48.3720930232558, NWO: 98.1566820276498, SPS: 91.21, SPO: 95, RMSD: 1.85)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1s16A01"

Flow stage update by auto on 28 Apr 2006 17:44

All required files are present for Domain "1s16A01"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1s16A01"

Insertion by auto on 05 Mar 2006 23:43

Cut based on decision in database "DomChop" on "cathdb"