CATH Domain: 1s14B00 XML data for domain: 1s14B00

Molscript image for 1s14B00
1s14B00
PDB coordinates for domain 1s14B00

PDB 1s14, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.565 Heat Shock Protein 90
3.30.565.10 Gene3D
3.30.565.10.11
3.30.565.10.11.1
3.30.565.10.11.1.1
3.30.565.10.11.1.1.1
3.30.565.10.11.1.1.1.1

[top]
Segment boundaries for domain 1s14B00

Chopping figure for domain 1s14B00
DomainStart PDB ResidueStop PDB Residue
1s14B00 2017 2217

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.565.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2o1wA01 80.59 Canis lupus familiarisPathways in cancerProstate cancerHeat shock protein 90kDa betaNOD-like receptor signaling pathway 3.30.565.10 172 12 83 3.80 4.54
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1s14B00
EPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCISVV
NALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVE
ITFKDEINNTEQRWCYQD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1s14B00
EPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCISVV
NALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVE
ITFKDEINNTEQRWCYQD
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 01 Nov 2006 14:38

Assigning to "3.30.565.10" based on similarity with "1s14A00"

Flow stage update by auto on 30 Oct 2006 18:18

No in_process hits for Domain "1s14B00" ready to be processed

Flow stage update by auto on 30 Oct 2006 18:18

NW result present for Domain "1s14B00"

Flow stage update by auto on 28 Oct 2006 01:49

All required files are present for Domain "1s14B00"

Flow stage update by auto on 27 Oct 2006 14:02

Beginning processing for Domain "1s14B00"

Insertion by cuff on 27 Oct 2006 10:17

nice selection of choppings. batch job