Set cath from cathlist by auto on 05 Mar 2006 18:18
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
CATH Domain: 1rzhM01
1rzhM01
PDB 1rzh, Chain M, Domain 1
Segment boundaries for domain 1rzhM01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1rzhM01 | 1 | 143 |
| 1rzhM02 | 144 | 301 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 1.20.85.10.1.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1jm0A00 | 70.82 | 1.20.5.420 | 48 | 12 | 33 | 1.62 | 4.83 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|1rzhM01 AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLGSLGVLSLFSGLMWFFTIGIWFWYQAGW NPAVFLRDLFFFSLEPPAPEYGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMG
Domain History Events (3)
Flow stage update by auto on 05 Mar 2006 18:18
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
Insertion by auto on 05 Mar 2006 17:42
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
