Domain assigned by auto on 28 Apr 2006 18:47
Assigning to "1.10.540.10" based on similarity with "1rx0A01" (NWSI: 100, NWO: 100, SPS: 99.36, SPO: 99, RMSD: 0.13)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1rx0C01 | 11 | 133 |
| 1rx0C02 | 134 | 238 |
| 1rx0C03 | 239 | 393 |
There are 6 matching structural neighberhood comparisons for CATH ID 1.10.540.10.3.1.1.1.1 (SIMAX score < 5)
>pdb|1rx0C01 SCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEAL ATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKF
Assigning to "1.10.540.10" based on similarity with "1rx0A01" (NWSI: 100, NWO: 100, SPS: 99.36, SPO: 99, RMSD: 0.13)
NW result present for Domain "1rx0C01"
All required files are present for Domain "1rx0C01"
Beginning processing for Domain "1rx0C01"