CATH Domain: 1ru0B00 XML data for domain: 1ru0B00

Molscript image for 1ru0B00
1ru0B00
PDB coordinates for domain 1ru0B00

PDB 1ru0, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1360 Gyrase A; domain 2
3.30.1360.20 Gene3D
3.30.1360.20.1
3.30.1360.20.1.1
3.30.1360.20.1.1.1
3.30.1360.20.1.1.1.1
3.30.1360.20.1.1.1.1.1

[top]
Segment boundaries for domain 1ru0B00

Chopping figure for domain 1ru0B00
DomainStart PDB ResidueStop PDB Residue
1ru0B00 4 101

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.30.1360.20.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1usmA00 87.98 Transcriptional coactivatorThermus thermophilus 3.30.1360.20 77 31 77 1.49 1.92
2phcB01 78.46 Pyrococcus horikoshiiPutative uncharacterized protein PH0987 3.30.1360.40 83 7 69 3.11 4.48
2j8sA07 77.38 Hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 familyAcriflavine resistance protein BProtein bindingEscherichia coli K-12 3.30.70.1440 94 9 70 3.36 4.77
1kafD00 77.12 Transcription regulatory protein motAEnterobacteria phage T4 3.90.1150.20 104 2 68 3.35 4.91
1eayD00 74.05 Bacterial chemotaxisTwo-component systemTwo-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]Escherichia coli K-12Chemotaxis protein cheA 3.30.70.400 69 2 61 2.99 4.88
2kt2A00 73.46 Mercuric reductasePseudomonas aeruginosaMercuric reductase [EC:1.16.1.1] 3.30.70.100 69 7 54 2.51 4.64
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ru0B00
DAQWLTAEERDQLIPGLKAAGWSELSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCG
GLTKRDVKLAQFIEKAAA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ru0B00
GSMSSDAQWLTAEERDQLIPGLKAAGWSELSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLT
SHDCGGLTKRDVKLAQFIEKAAASL
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:45

Assigning to "3.30.1360.20" based on similarity with "1ru0A00" (NWSI: 100, NWO: 100, SPS: 98.55, SPO: 98, RMSD: 0.31)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1ru0B00"

Flow stage update by auto on 28 Apr 2006 17:44

All required files are present for Domain "1ru0B00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1ru0B00"

Insertion by auto on 09 Mar 2006 02:01

Final ChopClose added based on similarity with "1ru0A" [LEE: 0, LME: 0, MR: 2, LG: 2, SS: 98.55, SI: 100, SO: 100]