CATH Domain: 1rtwB00 XML data for domain: 1rtwB00

Molscript image for 1rtwB00
1rtwB00
PDB coordinates for domain 1rtwB00

PDB 1rtw, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.910 Heme Oxygenase; Chain A
1.20.910.10 Heme Oxygenase; Chain A Gene3D
1.20.910.10.14
1.20.910.10.14.1
1.20.910.10.14.1.1
1.20.910.10.14.1.1.1
1.20.910.10.14.1.1.1.1

[top]
Segment boundaries for domain 1rtwB00

Chopping figure for domain 1rtwB00
DomainStart PDB ResidueStop PDB Residue
1rtwB00 2 209

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.20.910.10.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rcwB00 82.41 Chlamydia trachomatisPqqC-like proteinPyrroloquinoline-quinone synthase [EC:1.3.3.11] 1.20.910.10 210 16 93 3.50 3.73
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1rtwB00
FSEELIKENENIWRRFLPHKFLIEAENTIKKENFEKWLVNDYYFVKNALRFALLAKAPDDLLPFFAESIYYISKELEFEK
KAQELGISLNGEIDWRAKSYVNYLLSVASLGSFLEGFTALYCEEKAYYEAWKWVRENLKERSPYQEFINHWSSQEFGEYV
KRIEKILNSLAEKHGEFEKERAREVFKEVSKFELIFWDIAYGGE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1rtwB00
XFSEELIKENENIWRRFLPHKFLIEXAENTIKKENFEKWLVNDYYFVKNALRFXALLXAKAPDDLLPFFAESIYYISKEL
EXFEKKAQELGISLNGEIDWRAKSYVNYLLSVASLGSFLEGFTALYCEEKAYYEAWKWVRENLKERSPYQEFINHWSSQE
FGEYVKRIEKILNSLAEKHGEFEKERAREVFKEVSKFELIFWDIAYGGEGNVLEHHHHHH
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:45

Assigning to "1.20.910.10" based on similarity with "1rtwA00" (NWSI: 97.7272727272727, NWO: 100, SPS: 98.24, SPO: 98, RMSD: 0.21)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1rtwB00"

Flow stage update by auto on 28 Apr 2006 17:44

All required files are present for Domain "1rtwB00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1rtwB00"

Insertion by auto on 09 Mar 2006 02:01

Final ChopClose added based on similarity with "1rtwA" [LEE: 3, LME: 0, MR: 0, LG: 3, SS: 98.24, SI: 97.7272727272727, SO: 100]