CATH Domain: 1rtqA00 XML data for domain: 1rtqA00

Molscript image for 1rtqA00
1rtqA00
PDB coordinates for domain 1rtqA00

PDB 1rtq, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.10 Zn peptidases Gene3D
3.40.630.10.1
3.40.630.10.1.1
3.40.630.10.1.1.1
3.40.630.10.1.1.1.1
3.40.630.10.1.1.1.1.1

[top]
Segment boundaries for domain 1rtqA00

Chopping figure for domain 1rtqA00
DomainStart PDB ResidueStop PDB Residue
1rtqA00 1 291

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.40.630.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tkjA00 85.89 Streptomyces griseusAminopeptidase S 3.40.630.10 277 19 86 2.09 2.40
3kasA01 84.35 Integral to plasma membraneHematopoietic cell lineageExtracellular regionCoated pitEndocytosis 3.40.630.10 308 16 87 2.71 3.10
1z2lB01 82.71 Purine metabolismZinc ion bindingProtein homodimerization activityAllantoate deiminase [EC:3.5.3.9]Manganese ion binding 3.40.630.10 295 14 82 2.77 3.35
1cg2A01 82.20 Pseudomonas sp. RS-16Carboxypeptidase G2 3.40.630.10 279 15 87 2.99 3.43
1lfwA01 81.11 Lactobacillus delbrueckii subsp. lactisBeta-Ala-Xaa dipeptidase 3.40.630.10 274 10 83 3.62 4.32
1xmbA01 80.40 Auxin metabolic processArabidopsis thalianaIAA-Ala conjugate hydrolase activityIAA-amino acid hydrolase ILR1-like 2 3.40.630.10 274 8 87 3.62 4.13
2v8hA01 80.29 Beta-alanine synthaseLachancea kluyveri 3.40.630.10 315 14 77 2.90 3.74
3ifeA01 79.47 Bacillus anthracisPeptidase TTripeptide aminopeptidase [EC:3.4.11.4] 3.40.630.10 302 10 79 3.39 4.27
3ct9B01 79.37 Bacteroides thetaiotaomicronAcetylornithine deacetylase 3.40.630.10 233 14 73 3.31 4.48
1vgyA01 78.46 Succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Neisseria meningitidis serogroup BLysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase 3.40.630.10 256 13 82 3.81 4.64
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1rtqA00
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVM
TITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQD
LANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPA
AMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1rtqA00
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVM
TITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQD
LANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPA
AMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATGDTPTPGNQ
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:49

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"