CATH Domain: 1rsgB01 XML data for domain: 1rsgB01

Molscript image for 1rsgB01
1rsgB01
PDB coordinates for domain 1rsgB01

PDB 1rsg, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.50 3-Layer(bba) Sandwich
3.50.50 FAD/NAD(P)-binding domain
3.50.50.60 Gene3D
3.50.50.60.19
3.50.50.60.19.1
3.50.50.60.19.1.1
3.50.50.60.19.1.1.1
3.50.50.60.19.1.1.1.1

Segment boundaries for domain 1rsgB01

Chopping figure for domain 1rsgB01
DomainStart PDB ResidueStop PDB Residue
1rsgB01 8 47
1rsgB01 200 290
1rsgB01 455 511
1rsgB02 48 199
1rsgB02 291 454

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 3.50.50.60.19.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rsgA01 92.04 CytoplasmPolyamine oxidase FMS1Polyamine catabolic processSaccharomyces cerevisiaePrimary amine oxidase activity 3.50.50.60 242 99 74 1.14 1.52
2iidA02 87.68 Calloselasma rhodostomaL-amino-acid oxidase 3.50.50.60 148 32 79 1.59 2.00
1sezA01 85.45 Nicotiana tabacumProtoporphyrinogen oxidase, mitochondrial 3.50.50.60 177 20 88 3.75 4.22
3kkjA01 84.86 Pseudomonas syringae pv. tomatoAmine oxidase, flavin-containing protein 3.50.50.60 150 25 82 2.65 3.22
1b37A01 84.68 Polyamine oxidase (propane-1,3-diamine-forming) [EC:1.5.3.14]Zea maysPolyamine oxidase 3.50.50.60 241 32 69 2.23 3.22
1trbA01 83.52 Pyrimidine metabolismThioredoxin reductase (NADPH) [EC:1.8.1.9]Thioredoxin reductaseProtein bindingEscherichia coli K-12 3.50.50.60 187 13 80 2.77 3.45
3fbsB01 83.15 Agrobacterium tumefaciens str. C58Oxidoreductase 3.50.50.60 188 14 85 3.50 4.09
1xdiA01 79.13 Citrate cycle (TCA cycle)Valine, leucine and isoleucine degradationPyruvate metabolismGlycine, serine and threonine metabolismMetabolic pathways 3.50.50.60 218 13 71 3.37 4.74
3cgvA01 79.05 3.50.50.60 219 12 67 3.29 4.90
2gqfA01 78.93 Haemophilus influenzaeUncharacterized protein HI_0933 3.50.50.60 244 19 64 3.20 4.97
3c4nA01 77.21 Deinococcus radioduransPutative uncharacterized protein 3.50.50.60 233 13 63 2.81 4.39
1fl2A02 75.37 Alkyl hydroperoxide reductase subunit F [EC:1.6.4.-]Alkyl hydroperoxide reductase subunit FProtein bindingEscherichia coli K-12Cytosol 3.50.50.60 124 13 48 2.43 5.00
Displaying entries 1 to 12 (page 1 of 1)


Domain ATOM Sequence

>pdb|1rsgB01
KKKVIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGRNYDSVVQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCE
DGTVYNADYVIITVPQSVLNLSVQPEKNLRGRIEFQPPLKPVIQDAFDKIHPVDVVASNGQDSRIRFAGEHTIDGAGCAY
GAWESGRREATRISDLLKLEH    

Domain COMBS Sequence

>pdb|1rsgB01
XNTVSPAKKKVIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGRNYDSVVQRIAQSFPQNWLKLSCEVKSITREPSK
NVTVNCEDGTVYNADYVIITVPQSVLNLSVQPEKNLRGRIEFQPPLKPVIQDAFDKIHPGDDPVDXVVAXSNGQDSRIRF
AGEHTIXDGAGCAYGAWESGRREATRISDLLKLEHHHHHH    

Domain History Events (41)

Domain assigned by tronnberg on 14 Jan 2008 11:19

See above comment

Domain assignment manual match h by tronnberg on 14 Jan 2008 11:17

SSAP: 92.0 OV: 74 SEQ: 99. Both are Fms1 protein.

Homcheck review by tronnberg on 14 Jan 2008 11:17

SSAP: 92.0 OV: 74 SEQ: 99. Both are Fms1 protein.

Flow stage update by tronnberg on 14 Jan 2008 11:17

SSAP: 92.0 OV: 74 SEQ: 99. Both are Fms1 protein.

Homcheck allotment by tronnberg on 14 Jan 2008 11:14

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 14 Jan 2008 11:14

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 11 Jan 2008 17:11

Domain "1rsgB01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 11 Jan 2008 17:11

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 1rsgB01

Flow stage update by auto on 11 Jan 2008 15:22

Retrieved PRC_PFAMCATH results for job ID SID4974651942471168 and results inserted.

Domain scan prc pfamcath by auto on 11 Jan 2008 15:21

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2877 results for 1rsgB01

Update comment by auto on 10 Jan 2008 18:20

PRC_PFAMCATH job SID4974651942471168 is not yet finished.

Prc pfamcath submit by auto on 10 Jan 2008 18:14

The entry "1rsgB01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 10 Jan 2008 18:14

The entry "1rsgB01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 10 Jan 2008 17:46

Retrieved SSAP results for job ID SID3570174152590864 and results inserted.

Domain scan ssap cath by auto on 10 Jan 2008 17:44

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1531 results for 1rsgB01

Update comment by auto on 09 Jan 2008 18:17

SSAP job SID3570174152590864 is not yet finished.

Ssap cath submit by auto on 09 Jan 2008 17:56

The entry "1rsgB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Jan 2008 17:56

The entry "1rsgB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Jan 2008 17:30

Retrieved PRC results for job ID SID4562989977027025 and inserted them into the database.

Domain scan prc cath by auto on 09 Jan 2008 17:30

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 109 results for 1rsgB01

Update comment by auto on 09 Jan 2008 12:09

PRC job SID4562989977027025 is not yet finished.

Flow stage update by auto on 09 Jan 2008 11:54

The entry "1rsgB01" has been submitted to the PRC webservice.

Prc cath submit by auto on 09 Jan 2008 11:54

The entry "1rsgB01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Jan 2008 11:34

Retrieved HMM(SAM) results for job ID SID6491900311209776 and inserted them into the database.

Domain scan sam cath by auto on 09 Jan 2008 11:34

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 69 results for 1rsgB01

Update comment by auto on 08 Jan 2008 23:42

HMM(SAM) job SID6491900311209776 is not yet finished.

Sam cath submit by auto on 08 Jan 2008 23:40

The entry "1rsgB01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 08 Jan 2008 23:40

The entry "1rsgB01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 08 Jan 2008 23:31

Retrieved "1rsgB01" CATHEDRAL results for job ID SID4628860849137120 and inserted them into the database.

Domain scan cathedral cath by auto on 08 Jan 2008 23:30

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 459 results for 1rsgB01

Update comment by auto on 07 Jan 2008 02:32

"1rsgB01" CATHEDRAL job SID4628860849137120 is not yet finished.

Cathedral cath submit by auto on 07 Jan 2008 02:31

The entry "1rsgB01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 07 Jan 2008 02:31

The entry "1rsgB01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 07 Jan 2008 02:30

ScanList with 11660 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1rsgB01.scanlist" for "1rsgB01"

Write scan list by auto on 07 Jan 2008 02:30

Writing ScanList containing 11660 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1rsgB01.scanlist" for domain "1rsgB01"

Flow stage update by auto on 20 Jul 2007 16:01

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Mar 2007 15:10

No in_process hits for Domain "1rsgB01" ready to be processed

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "1rsgB01"

Flow stage update by auto on 14 Mar 2007 15:02

All required files are present for Domain "1rsgB01"

Flow stage update by auto on 14 Mar 2007 15:00

Beginning processing for Domain "1rsgB01"

Insertion by auto on 05 Mar 2006 23:42

Cut based on decision in database "DomChop" on "cathdb"