Domain assigned by tronnberg on 14 Jan 2008 11:19
See above comment
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.50
| 3-Layer(bba) Sandwich | |
3.50.50
| FAD/NAD(P)-binding domain | |
3.50.50.60
| Gene3D | |
3.50.50.60.19
| ||
3.50.50.60.19.1
| ||
3.50.50.60.19.1.1
| ||
3.50.50.60.19.1.1.1
| ||
3.50.50.60.19.1.1.1.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1rsgB01 | 8 | 47 |
| 1rsgB01 | 200 | 290 |
| 1rsgB01 | 455 | 511 |
| 1rsgB02 | 48 | 199 |
| 1rsgB02 | 291 | 454 |
There are 12 matching structural neighberhood comparisons for CATH ID 3.50.50.60.19.1.1.1.1 (SIMAX score < 5)
>pdb|1rsgB01 KKKVIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGRNYDSVVQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCE DGTVYNADYVIITVPQSVLNLSVQPEKNLRGRIEFQPPLKPVIQDAFDKIHPVDVVASNGQDSRIRFAGEHTIDGAGCAY GAWESGRREATRISDLLKLEH
See above comment
SSAP: 92.0 OV: 74 SEQ: 99. Both are Fms1 protein.
SSAP: 92.0 OV: 74 SEQ: 99. Both are Fms1 protein.
SSAP: 92.0 OV: 74 SEQ: 99. Both are Fms1 protein.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "1rsgB01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 1rsgB01
Retrieved PRC_PFAMCATH results for job ID SID4974651942471168 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2877 results for 1rsgB01
PRC_PFAMCATH job SID4974651942471168 is not yet finished.
The entry "1rsgB01" has been submitted to the PRC_PFAMCATH webservice.
The entry "1rsgB01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID3570174152590864 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1531 results for 1rsgB01
SSAP job SID3570174152590864 is not yet finished.
The entry "1rsgB01" has been submitted to the SSAP webservice.
The entry "1rsgB01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID4562989977027025 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 109 results for 1rsgB01
PRC job SID4562989977027025 is not yet finished.
The entry "1rsgB01" has been submitted to the PRC webservice.
The entry "1rsgB01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID6491900311209776 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 69 results for 1rsgB01
HMM(SAM) job SID6491900311209776 is not yet finished.
The entry "1rsgB01" has been submitted to the HMM (SAM) webservice.
The entry "1rsgB01" has been submitted to the HMM (SAM) webservice.
Retrieved "1rsgB01" CATHEDRAL results for job ID SID4628860849137120 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 459 results for 1rsgB01
"1rsgB01" CATHEDRAL job SID4628860849137120 is not yet finished.
The entry "1rsgB01" has been submitted to the CATHEDRAL webservice.
The entry "1rsgB01" has been submitted to the CATHEDRAL webservice.
ScanList with 11660 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1rsgB01.scanlist" for "1rsgB01"
Writing ScanList containing 11660 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1rsgB01.scanlist" for domain "1rsgB01"
No satisfactory AssignClose result found.
No in_process hits for Domain "1rsgB01" ready to be processed
NW result present for Domain "1rsgB01"
All required files are present for Domain "1rsgB01"
Beginning processing for Domain "1rsgB01"
Cut based on decision in database "DomChop" on "cathdb"