CATH Domain: 1rrmA02 XML data for domain: 1rrmA02

Molscript image for 1rrmA02
1rrmA02
PDB coordinates for domain 1rrmA02

PDB 1rrm, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1090 Dehydroquinate synthase-like, alpha domain
1.20.1090.10 Dehydroquinate synthase-like - alpha domain Gene3D
1.20.1090.10.2
1.20.1090.10.2.1
1.20.1090.10.2.1.1
1.20.1090.10.2.1.1.1
1.20.1090.10.2.1.1.1.1

[top]
Segment boundaries for domain 1rrmA02

Chopping figure for domain 1rrmA02
DomainStart PDB ResidueStop PDB Residue
1rrmA01 3 186
1rrmA02 187 386

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.20.1090.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1o2dA02 88.25 Tyrosine metabolismThermotoga maritimaAlcohol dehydrogenase, iron-containingAlcohol dehydrogenase [EC:1.1.1.1]Glycolysis / Gluconeogenesis 1.20.1090.10 173 27 88 1.90 2.14
1oj7A02 87.12 Zinc ion bindingAlcohol dehydrogenase (NADP+) activityEscherichia coli K-12Alcohol dehydrogenase activity, zinc-dependentAlcohol dehydrogenase yqhD 1.20.1090.10 204 24 93 2.76 2.95
3ce9A02 78.58 Glycerol dehydrogenaseClostridium acetobutylicum 1.20.1090.10 187 10 83 3.44 4.12
1sg6A02 78.56 Pentafunctional AROM polypeptideEmericella nidulans 1.20.1090.10 197 10 76 3.19 4.19
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1rrmA02
PALKAATGVDALTHAIEGYITRGAWALTDALHIKAIEIIAGALRGSVAGDKDAGEEALGQYVAGGFSNVGLGLVHGAHPL
GAFYNTPHGVANAILLPHVRYNADFTGEKYRDIARVGVKVEGSLEEARNAAVEAVFALNRDVGIPPHLRDVGVRKEDIPA
LAQAALDDVCTGGNPREATLEDIVELYHTAWEGG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1rrmA02
PALKAATGVDALTHAIEGYITRGAWALTDALHIKAIEIIAGALRGSVAGDKDAGEEXALGQYVAGXGFSNVGLGLVHGXA
HPLGAFYNTPHGVANAILLPHVXRYNADFTGEKYRDIARVXGVKVEGXSLEEARNAAVEAVFALNRDVGIPPHLRDVGVR
KEDIPALAQAALDDVCTGGNPREATLEDIVELYHTAWEGG
BLAST against CATH

[top]
Domain History Events (5)

Domain move by cuff on 25 Apr 2006 22:03

COMMENT: Lesley - Yes, these belong in the same T-level and superfamily. Merge. Interestingly, this should have been assigned on the homolcheck pages but the data might not have been available to show this relationship. Check the homolcheck pages. FINAL: Lesley - Move 1rrmA02 and sequence family to 1.20.1090.10. This will give 1rrmA02 and S35 sequence family a new T and H level number than the one currently listed (120.270).

Flow stage update by cuff on 25 Apr 2006 22:03

COMMENT: Lesley - Yes, these belong in the same T-level and superfamily. Merge. Interestingly, this should have been assigned on the homolcheck pages but the data might not have been available to show this relationship. Check the homolcheck pages. FINAL: Lesley - Move 1rrmA02 and sequence family to 1.20.1090.10. This will give 1rrmA02 and S35 sequence family a new T and H level number than the one currently listed (120.270).

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:41

Cut based on decision in database "DomChop" on "cathdb"