CATH Domain: 1rq2B02 XML data for domain: 1rq2B02

Molscript image for 1rq2B02
1rq2B02
PDB coordinates for domain 1rq2B02

PDB 1rq2, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1330 60s Ribosomal Protein L30; Chain: A;
3.30.1330.20 Gene3D
3.30.1330.20.3
3.30.1330.20.3.1
3.30.1330.20.3.1.1
3.30.1330.20.3.1.1.1
3.30.1330.20.3.1.1.1.1

[top]
Segment boundaries for domain 1rq2B02

Chopping figure for domain 1rq2B02
DomainStart PDB ResidueStop PDB Residue
1rq2B01 8 217
1rq2B02 218 313

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.1330.20.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tvkB02 79.00 Gap junctionPathogenic Escherichia coli infectionTubulin betaBos taurusTubulin beta-2B chain 3.30.1330.20 114 11 82 3.28 3.98
1u1iA02 78.73 Archaeoglobus fulgidusMyo-inositol-1-phosphate synthase (Ino1)Streptomycin biosynthesisMyo-inositol-1-phosphate synthase [EC:5.5.1.4]Inositol phosphate metabolism 3.30.360.10 101 6 75 3.44 4.57
1tvkA02 78.00 Gap junctionTubulin alphaTubulin alpha-1D chainBos taurus 3.30.1330.20 115 6 77 3.49 4.51
3d01E00 74.49 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 3.30.1330.40 152 15 61 2.96 4.79
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1rq2B02
AGTALMGIGSARGEGRSLKAAEIAINSPLLEASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDD
SLGDEVRVTVIAAGFD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1rq2B02
AGTALMGIGSARGEGRSLKAAEIAINSPLLEASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDD
SLGDEVRVTVIAAGFD
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 01 Nov 2006 22:00

Assigning to "3.30.1330.20" based on similarity with "1rluA02"

Flow stage update by auto on 01 Nov 2006 21:56

No in_process hits for Domain "1rq2B02" ready to be processed

Update comment by auto on 01 Nov 2006 18:03

Domain "1rq2B02" hits Domain "1rluA02" (100% over 98.9583333333333%) which is currently in process

Update comment by auto on 01 Nov 2006 14:26

Domain "1rq2B02" hits Domain "1rluB02" (100% over 98.9583333333333%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "1rq2B02" hits Domain "1rluB02" (100% over 98.9583333333333%) which is currently in process

Update comment by auto on 01 Nov 2006 05:49

Domain "1rq2B02" hits Domain "1rluB02" (100% over 98.9583333333333%) which is currently in process

Update comment by auto on 01 Nov 2006 02:08

Domain "1rq2B02" hits Domain "1rluB02" (100% over 98.9583333333333%) which is currently in process

Flow stage update by auto on 17 Oct 2006 00:41

Domain "1rq2B02" hits Domain "1rluB02" (100% over 98.9583333333333%) which is currently in process

Flow stage update by auto on 17 Oct 2006 00:41

NW result present for Domain "1rq2B02"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "1rq2B02"

Flow stage update by auto on 16 Oct 2006 08:42

Beginning processing for Domain "1rq2B02"

Insertion by auto on 16 Oct 2006 08:16

Final ChopClose added based on similarity with "1rq7B"