CATH Domain: 1rl6A02 XML data for domain: 1rl6A02

Molscript image for 1rl6A02
1rl6A02
PDB coordinates for domain 1rl6A02

PDB 1rl6, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.930 Outer Surface Protein A; domain 3
3.90.930.12 Gene3D
3.90.930.12.1
3.90.930.12.1.1
3.90.930.12.1.1.1
3.90.930.12.1.1.1.1
3.90.930.12.1.1.1.1.1

[top]
Segment boundaries for domain 1rl6A02

Chopping figure for domain 1rl6A02
DomainStart PDB ResidueStop PDB Residue
1rl6A01 7 81
1rl6A02 82 170

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.90.930.12.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vq8E02 86.69 Large subunit ribosomal protein L6RibosomeHaloarcula marismortui50S ribosomal protein L6P 3.90.930.12 93 16 91 2.99 3.27
1vq8E01 83.45 Large subunit ribosomal protein L6RibosomeHaloarcula marismortui50S ribosomal protein L6P 3.90.930.12 79 8 82 3.22 3.93
1rl6A01 82.63 RibosomeLarge subunit ribosomal protein L6Geobacillus stearothermophilus50S ribosomal protein L6 3.90.930.12 75 10 78 3.26 4.14
3i1nG01 80.71 RibosomeLarge subunit ribosomal protein L650S ribosomal protein L6Protein bindingEscherichia coli K-12 3.90.930.12 81 6 78 2.58 3.28
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1rl6A02
YEKALELVGVGYRASKQGKKLVLSVGYSHPVEIEPEEGLEIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKGI
RYEGELVRL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1rl6A02
YEKALELVGVGYRASKQGKKLVLSVGYSHPVEIEPEEGLEIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKGI
RYEGELVRLKEGKTGK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:40

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"