CATH Domain: 1rl0A01 XML data for domain: 1rl0A01

Molscript image for 1rl0A01
1rl0A01
PDB coordinates for domain 1rl0A01

PDB 1rl0, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.420 Ricin (A subunit); domain 1
3.40.420.10 Ricin (A subunit), domain 1 Gene3D
3.40.420.10.4
3.40.420.10.4.2
3.40.420.10.4.2.1
3.40.420.10.4.2.1.1
3.40.420.10.4.2.1.1.1

Segment boundaries for domain 1rl0A01

Chopping figure for domain 1rl0A01
DomainStart PDB ResidueStop PDB Residue
1rl0A01 1 181
1rl0A02 182 255

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.420.10.4.2.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ktzA01 87.61 Ribosome-inactivating protein geloninGelonium multiflorum 3.40.420.10 168 24 90 1.95 2.16
1abrA01 87.49 RRNA N-glycosylase activityAbrus precatoriusAbrin-aGalactose bindingNegative regulation of translation 3.40.420.10 166 23 91 2.14 2.34
1r4pA01 85.52 Pathogenic Escherichia coli infectionShiga toxin subunit AShiga-like toxin 2 subunit AEnterobacteria phage 933W 3.40.420.10 170 19 89 2.97 3.31
Displaying entries 1 to 3 (page 1 of 1)


Domain ATOM Sequence

>pdb|1rl0A01
ATAYTLNLANPSASQYSSFLDQIRNNVRDTSLIYGGTDVAVIGAPSTTDKFLRLNFQGPRGTVSLGLRRENLYVVAYLAM
DNANVNRAYYFKNQITSAELTALFPEVVVANQKQLEYGEDYQAIEKNAKITTGDQSRKELGLGINLLITMIDGVNKKVRV
VKDEARFLLIAIQMTAEAARF    

Domain COMBS Sequence

>pdb|1rl0A01
ATAYTLNLANPSASQYSSFLDQIRNNVRDTSLIYGGTDVAVIGAPSTTDKFLRLNFQGPRGTVSLGLRRENLYVVAYLAM
DNANVNRAYYFKNQITSAELTALFPEVVVANQKQLEYGEDYQAIEKNAKITTGDQSRKELGLGINLLITMIDGVNKKVRV
VKDEARFLLIAIQMTAEAARF    

Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:42

Assigning to "3.40.420.10" based on similarity with "1lpcA01" (NWSI: 99.4475138121547, NWO: 100, SPS: 98.33, SPO: 100, RMSD: 0.37)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1rl0A01"

Flow stage update by auto on 28 Apr 2006 17:44

All required files are present for Domain "1rl0A01"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1rl0A01"

Insertion by auto on 09 Mar 2006 01:29

Final ChopClose added based on similarity with "1lp8A" [LEE: 1, LME: 0, MR: 0, LG: 1, SS: 98.43, SI: 99.6062992125984, SO: 99.6078431372549]