Domain assigned by auto on 28 Apr 2006 18:38
Assigning to "1.20.910.10" based on similarity with "1rcwA00" (NWSI: 98.2683982683983, NWO: 100, SPS: 99.55, SPO: 99, RMSD: 0.08)
There are 1 matching structural neighberhood comparisons for CATH ID 1.20.910.10.15.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2itbB00 | 75.85 | 1.20.1260.10 | 193 | 8 | 84 | 4.17 | 4.95 |
>pdb|1rcwB00 NFLDQLDLIIQNKHLEHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYLSAIHSRCDDLEARKLLLDNLDEENGYPNH IDLWKQFVFALGVTPEELEAHEPSEAAKAKVATFRWCTGDSLAAGVAALYSYESQIPRIAREKIRGLTEYFGFSNPEDYA YFTEHEEADVRHAREEKALIELLKDDADKVLEASQEVTQSLYGFLDSFLD
Assigning to "1.20.910.10" based on similarity with "1rcwA00" (NWSI: 98.2683982683983, NWO: 100, SPS: 99.55, SPO: 99, RMSD: 0.08)
NW result present for Domain "1rcwB00"
All required files are present for Domain "1rcwB00"
Beginning processing for Domain "1rcwB00"