CATH Domain: 1ra9A00 XML data for domain: 1ra9A00

Molscript image for 1ra9A00
1ra9A00
PDB coordinates for domain 1ra9A00

PDB 1ra9, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.430 Dihydrofolate Reductase, subunit A
3.40.430.10 Dihydrofolate Reductase, subunit A Gene3D
3.40.430.10.4
3.40.430.10.4.1
3.40.430.10.4.1.1
3.40.430.10.4.1.1.2
3.40.430.10.4.1.1.2.1

[top]
Segment boundaries for domain 1ra9A00

Chopping figure for domain 1ra9A00
DomainStart PDB ResidueStop PDB Residue
1ra9A00 1 159

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.40.430.10.4.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ix9A00 91.72 One carbon pool by folateDihydrofolate reductaseFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3]Metabolic pathways 3.40.430.10 166 33 95 1.43 1.49
3dfrA00 91.19 One carbon pool by folateLactobacillus caseiDihydrofolate reductaseFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 162 26 96 1.60 1.65
1vdrA00 88.92 One carbon pool by folateDihydrofolate reductaseHaloferax volcaniiFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 157 30 95 1.72 1.80
1qzfA01 88.27 Pyrimidine metabolismThymidylate synthase [EC:2.1.1.45]One carbon pool by folateBifunctional dihydrofolate reductase-thymidylate synthaseFolate biosynthesis 3.40.430.10 176 30 88 1.87 2.12
1cz3B00 87.60 Thermotoga maritimaDihydrofolate reductase 3.40.430.10 168 22 91 2.61 2.87
1aoeA00 85.68 Dihydrofolate reductaseCandida albicans 3.40.430.10 192 29 80 2.66 3.29
2fziA00 85.54 Pneumocystis cariniiDihydrofolate reductase 3.40.430.10 206 30 75 1.69 2.23
2bl9A00 85.20 Bifunctional dihydrofolate reductase-thymidylate synthasePlasmodium vivax 3.40.430.10 216 25 72 1.59 2.20
1juvA00 84.12 Dihydrofolate reductaseEnterobacteria phage T4 3.40.430.10 193 21 79 2.30 2.88
2hxvA02 81.57 Riboflavin metabolismMetabolic pathwaysThermotoga maritimaDiaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]Riboflavin-specific deaminase 3.40.430.10 193 16 76 2.84 3.70
2p4gA00 77.48 Corynebacterium diphtheriaePutative uncharacterized protein 3.40.430.10 244 13 62 2.65 4.25
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ra9A00
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDE
AIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ra9A00
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDE
AIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1ra9000" to "1ra9A00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:48

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"