CATH Domain: 1r8eA02 XML data for domain: 1r8eA02

Molscript image for 1r8eA02
1r8eA02
PDB coordinates for domain 1r8eA02

PDB 1r8e, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1660 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2
1.10.1660.10 Gene3D
1.10.1660.10.4
1.10.1660.10.4.1
1.10.1660.10.4.1.1
1.10.1660.10.4.1.1.1
1.10.1660.10.4.1.1.1.1

[top]
Segment boundaries for domain 1r8eA02

Chopping figure for domain 1r8eA02
DomainStart PDB ResidueStop PDB Residue
1r8eA01 120 277
1r8eA02 3 75
1r8eA03 76 119

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.1660.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rh6A00 82.93 Enterobacteria phage lambdaExcisionase 1.10.1660.20 54 12 68 1.94 2.83
1s26D01 74.73 Calcium signaling pathwayPhosphatidylinositol signaling systemOocyte meiosisMelanogenesisInsulin signaling pathway 1.10.238.10 59 6 68 2.52 3.68
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1r8eA02
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1r8eA02
MKESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:39

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"