CATH Domain: 1r8dB00 XML data for domain: 1r8dB00

Molscript image for 1r8dB00
1r8dB00
PDB coordinates for domain 1r8dB00

PDB 1r8d, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1660 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2
1.10.1660.10 Gene3D
1.10.1660.10.3
1.10.1660.10.3.2
1.10.1660.10.3.2.1
1.10.1660.10.3.2.1.1
1.10.1660.10.3.2.1.1.1

[top]
Segment boundaries for domain 1r8dB00

Chopping figure for domain 1r8dB00
DomainStart PDB ResidueStop PDB Residue
1r8dB00 1 107

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.1660.10.3.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1r8eA02 87.58 Multidrug-efflux transporter 1 regulatorBacillus subtilis 1.10.1660.10 73 31 70 1.17 1.67
1rh6A00 73.93 Enterobacteria phage lambdaExcisionase 1.10.1660.20 54 3 49 2.35 4.80
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1r8dB00
MKYQVKQVAEISGVSIRTLHHYDNIELLNPSALTDAGYRLYSDADLERLQQILFFKEIGFRLDEIKEMLDHPNFDRKAAL
QSQKEILMKKKQRMDEMIQTIDRTLLS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1r8dB00
MKYQVKQVAEISGVSIRTLHHYDNIELLNPSALTDAGYRLYSDADLERLQQILFFKEIGFRLDEIKEMLDHPNFDRKAAL
QSQKEILMKKKQRMDEMIQTIDRTLLSVD
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:38

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"