CATH Domain: 1r62A00 XML data for domain: 1r62A00

Molscript image for 1r62A00
1r62A00
PDB coordinates for domain 1r62A00

PDB 1r62, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.565 Heat Shock Protein 90
3.30.565.10 Gene3D
3.30.565.10.13
3.30.565.10.13.1
3.30.565.10.13.1.1
3.30.565.10.13.1.1.1
3.30.565.10.13.1.1.1.1

[top]
Segment boundaries for domain 1r62A00

Chopping figure for domain 1r62A00
DomainStart PDB ResidueStop PDB Residue
1r62A00 194 349

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.565.10.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gkzA01 82.76 ATP bindingMitochondrial alpha-ketoglutarate dehydrogenase complexRattus norvegicus[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4][3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase activity 3.30.565.10 159 16 76 2.47 3.22
1bxdA00 81.75 Two-component systemOsmolarity sensor protein envZTwo-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC:2.7.13.3]Protein bindingEscherichia coli K-12 3.30.565.10 161 22 73 2.87 3.88
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1r62A00
RVTESIHKVAERVVTLVSMELPDNVRLIRDYDPSLPELAHDPDQIEQVLLNIVRNALQALGPEGGEIILRTRTAFQLTLH
GERYRLAARIDVEDNGPGIGLGLSIARNLIDQHSGKIEFTSWPGHTEFSVYLPIRK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1r62A00
LPGTRVTESIHKVAERVVTLVSMELPDNVRLIRDYDPSLPELAHDPDQIEQVLLNIVRNALQALGPEGGEIILRTRTAFQ
LTLHGERYRLAARIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFTSWPGHTEFSVYLPIRK
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:38

Cut based on decision in database "DomChop" on "cathdb"