Domain assigned by auto on 28 Apr 2006 18:36
Assigning to "3.40.140.10" based on similarity with "1r5tA00" (NWSI: 100, NWO: 100, SPS: 97.56, SPO: 97, RMSD: 0.58)
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.140.10.5.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
3ijfX00 | 90.11 | 3.40.140.10 | 123 | 30 | 88 | 2.00 | 2.26 |
>pdb|1r5tB00 MKVGGIEDRQLEALKRAALKACELSYSPYSHFRVGCSILTNNDVIFTGANVENASYSNCICAERSAMIQVLMAGHRSGWK CMVICGDSEDQCVSPCGVCRQFINEFVVKDFPIVMLNSTGSRSKVMTMGELLPMAFGPS
Assigning to "3.40.140.10" based on similarity with "1r5tA00" (NWSI: 100, NWO: 100, SPS: 97.56, SPO: 97, RMSD: 0.58)
NW result present for Domain "1r5tB00"
All required files are present for Domain "1r5tB00"
Beginning processing for Domain "1r5tB00"