CATH Domain: 1r3dA00 XML data for domain: 1r3dA00

Molscript image for 1r3dA00
1r3dA00
PDB coordinates for domain 1r3dA00

PDB 1r3d, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1820 Gene3D
3.40.50.1820.62
3.40.50.1820.62.1
3.40.50.1820.62.1.1
3.40.50.1820.62.1.1.1
3.40.50.1820.62.1.1.1.1

[top]
Segment boundaries for domain 1r3dA00

Chopping figure for domain 1r3dA00
DomainStart PDB ResidueStop PDB Residue
1r3dA00 0 263

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.40.50.1820.62.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bdiA00 79.44 Putative uncharacterized protein Ta0194Thermoplasma acidophilum 3.40.50.1820 199 16 65 2.35 3.60
1c4xA00 78.89 Biphenyl degradation2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase2,6-dioxo-6-phenylhexa-3-enoate hydrolase [EC:3.7.1.8]Metabolic pathwaysFluorene degradation 3.40.50.1820 281 14 82 3.63 4.38
2o2gA00 78.41 Dienelactone hydrolaseAnabaena variabilis ATCC 29413 3.40.50.1820 210 14 67 2.89 4.30
1imjA00 77.88 Abhydrolase domain-containing protein 14BHomo sapiensAbhydrolase domain-containing protein 14 3.40.50.1820 208 18 68 2.90 4.22
1jmkC01 75.39 Bacillus subtilisSurfactin synthase subunit 3Nonribosomal peptide structures 3.40.50.1820 172 13 61 3.00 4.90
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1r3dA00
SLLSNQLHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPAEAVEIEQTVQAHVTSEVPVIL
VGYSLGGRLIHGLAQGAFSRLNLRGAIIEGGHFGLQENEEKAARWQHDQQWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQ
RQTLIAQRSANLGSSVAHLLATSLAKQPYLLPALQALKLPIHYVCGEQDSKFQQLAESSGLSYSQVAQAGHNVHHEQPQA
FAKIVQAIHSIID
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1r3dA00
SLLSNQLHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPERHCDNFAEAVEXIEQTVQAHV
TSEVPVILVGYSLGGRLIXHGLAQGAFSRLNLRGAIIEGGHFGLQENEEKAARWQHDQQWAQRFSQQPIEHVLSDWYQQA
VFSSLNHEQRQTLIAQRSANLGSSVAHXLLATSLAKQPYLLPALQALKLPIHYVCGEQDSKFQQLAESSGLSYSQVAQAG
HNVHHEQPQAFAKIVQAXIHSIID
BLAST against CATH

[top]
Domain History Events (40)

Domain assigned by cuff on 31 Aug 2010 17:53

same superfamily

Domain assignment manual match h by tronnberg on 10 Jan 2008 11:23

SSAP: 84.3 OV: 92 SEQ: 16. The query's function is unknown.

Homcheck review by tronnberg on 10 Jan 2008 11:23

SSAP: 84.3 OV: 92 SEQ: 16. The query's function is unknown.

Flow stage update by tronnberg on 10 Jan 2008 11:23

SSAP: 84.3 OV: 92 SEQ: 16. The query's function is unknown.

Homcheck allotment by tronnberg on 10 Jan 2008 11:20

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 10 Jan 2008 11:20

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 06 Jan 2008 14:36

Calculated SCOP results for 1r3dA00 and inserted them into the database.

Domain scan scop cath by auto on 06 Jan 2008 14:36

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 69 results for 1r3dA00

Flow stage update by auto on 06 Jan 2008 13:09

Retrieved PRC_PFAMCATH results for job ID SID9702415348467008 and results inserted.

Domain scan prc pfamcath by auto on 06 Jan 2008 13:09

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1730 results for 1r3dA00

Prc pfamcath submit by auto on 06 Jan 2008 12:53

The entry "1r3dA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Jan 2008 12:53

The entry "1r3dA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Jan 2008 12:34

Retrieved SSAP results for job ID SID8375512654617296 and results inserted.

Domain scan ssap cath by auto on 06 Jan 2008 12:33

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1083 results for 1r3dA00

Update comment by auto on 03 Jan 2008 02:59

SSAP job SID8375512654617296 is not yet finished.

Ssap cath submit by auto on 03 Jan 2008 02:45

The entry "1r3dA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Jan 2008 02:45

The entry "1r3dA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Jan 2008 02:42

Retrieved PRC results for job ID SID1761638957255832 and inserted them into the database.

Domain scan prc cath by auto on 03 Jan 2008 02:42

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 69 results for 1r3dA00

Update comment by auto on 02 Jan 2008 23:35

PRC job SID1761638957255832 is not yet finished.

Prc cath submit by auto on 02 Jan 2008 23:29

The entry "1r3dA00" has been submitted to the PRC webservice.

Flow stage update by auto on 02 Jan 2008 23:29

The entry "1r3dA00" has been submitted to the PRC webservice.

Flow stage update by auto on 02 Jan 2008 23:27

Retrieved HMM(SAM) results for job ID SID2071699371969664 and inserted them into the database.

Domain scan sam cath by auto on 02 Jan 2008 23:27

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 47 results for 1r3dA00

Update comment by auto on 02 Jan 2008 20:35

HMM(SAM) job SID2071699371969664 is not yet finished.

Sam cath submit by auto on 02 Jan 2008 20:30

The entry "1r3dA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Jan 2008 20:30

The entry "1r3dA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Jan 2008 20:27

Retrieved "1r3dA00" CATHEDRAL results for job ID SID9710255534243816 and inserted them into the database.

Domain scan cathedral cath by auto on 02 Jan 2008 20:26

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 450 results for 1r3dA00

Update comment by auto on 02 Jan 2008 17:18

"1r3dA00" CATHEDRAL job SID9710255534243816 is not yet finished.

Flow stage update by auto on 02 Jan 2008 17:13

The entry "1r3dA00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 02 Jan 2008 17:13

The entry "1r3dA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Jan 2008 17:13

ScanList with 11658 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1r3dA00.scanlist" for "1r3dA00"

Write scan list by auto on 02 Jan 2008 17:13

Writing ScanList containing 11658 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1r3dA00.scanlist" for domain "1r3dA00"

Flow stage update by auto on 30 Aug 2007 02:22

No satisfactory AssignClose result found.

Flow stage update by auto on 30 Aug 2007 02:10

No in_process hits for Domain "1r3dA00" ready to be processed

Flow stage update by auto on 30 Aug 2007 02:10

NW result present for Domain "1r3dA00"

Flow stage update by auto on 23 Aug 2007 10:08

All required files are present for Domain "1r3dA00"

Flow stage update by auto on 22 Aug 2007 15:19

Beginning processing for Domain "1r3dA00"

Insertion by cuff on 22 Aug 2007 12:43

nice chopping