CATH Domain: 1r1pB00 XML data for domain: 1r1pB00

Molscript image for 1r1pB00
1r1pB00
PDB coordinates for domain 1r1pB00

PDB 1r1p, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.7
3.30.505.10.7.1
3.30.505.10.7.1.1
3.30.505.10.7.1.1.1
3.30.505.10.7.1.1.1.1

[top]
Segment boundaries for domain 1r1pB00

Chopping figure for domain 1r1pB00
DomainStart PDB ResidueStop PDB Residue
1r1pB00 50 149

Structural Neighbourhood (18 entries)

There are 18 matching structural neighberhood comparisons for CATH ID 3.30.505.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 18 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2oq1A03 88.10 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 99 24 90 2.12 2.36
1i3zA00 88.08 Mus musculusSH2 domain-containing protein 1BNegative regulation of natural killer cell mediated cytotoxicityNegative regulation of peptidyl-tyrosine phosphorylationPhosphotyrosine binding 3.30.505.10 102 27 88 2.17 2.46
1ayaA00 87.95 Hormone-mediated signaling pathwayRegulation of multicellular organism growthNerve growth factor receptor signaling pathwayTriglyceride metabolic processNegative regulation of insulin secretion 3.30.505.10 101 34 91 1.84 2.02
2shpA02 87.84 Tyrosine-protein phosphatase non-receptor type 11Homo sapiens 3.30.505.10 101 32 91 1.89 2.07
2crhA01 87.09 Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis 3.30.505.10 102 26 94 2.97 3.16
2dm0A01 86.26 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 25 87 1.92 2.21
2oq1A01 85.93 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 108 22 86 3.17 3.68
3bkbA01 85.61 Tyrosine-protein kinase Fes/FpsHomo sapiensCell proliferationMulticellular organismal development 3.30.505.10 93 24 89 3.49 3.92
1milA00 85.36 Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 104 24 91 2.91 3.19
2iugA00 85.08 ErbB-3 class receptor bindingInsulin-like growth factor receptor signaling pathwayInsulin receptor signaling pathwayGrowth hormone receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 110 20 89 3.78 4.24
1ju5A00 85.06 Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway 3.30.505.10 109 26 80 1.94 2.40
2pldA00 83.54 Phosphatidylinositol signaling systemCalcium signaling pathwayPhospholipase C, gamma [EC:3.1.4.11]Pathways in cancerNeurotrophin signaling pathway 3.30.505.10 105 30 89 2.74 3.06
3buxB03 83.20 Jak-STAT signaling pathwayPathways in cancerT cell receptor signaling pathwayErbB signaling pathwayChronic myeloid leukemia 3.30.505.10 86 11 73 2.33 3.19
2vifA01 83.08 CytoplasmJAK-STAT cascadeDefense responseSuppressor of cytokine signaling 6Suppressor of cytokine signaling 6 3.30.505.10 126 20 78 3.70 4.71
1rpyB00 83.01 SH2B adapter protein 2Nervous system developmentRattus norvegicusInsulin signaling pathwayNeurotrophin signaling pathway 3.30.505.10 85 20 70 2.57 3.67
2kk6A00 82.97 CytoplasmFer (fps/fes related) tyrosine kinase [EC:2.7.10.2]Homo sapiensAdherens junctionTyrosine-protein kinase Fer 3.30.505.10 116 25 83 4.07 4.87
1bg1A04 76.40 Positive regulation of transcription from RNA polymerase II promoterTemperature homeostasisRegulation of multicellular organism growthNucleusPlasma membrane 3.30.505.10 109 15 67 2.73 4.02
1bf5A04 74.53 Jak-STAT signaling pathwayPathways in cancerChemokine signaling pathwayNucleolusProtein binding 3.30.505.10 112 11 61 2.72 4.42
[1]
Displaying entries 1 to 18 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1r1pB00
GSFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNK
LVDYYRTTSISKQKQVFLRD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1r1pB00
GSFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNK
LVDYYRTTSISKQKQVFLRD
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:34

Assigning to "3.30.505.10" based on similarity with "1r1sE00" (NWSI: 100, NWO: 100, SPS: 94.78, SPO: 99, RMSD: 3.24)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1r1pB00"

Flow stage update by auto on 28 Apr 2006 17:44

All required files are present for Domain "1r1pB00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1r1pB00"

Insertion by auto on 08 Mar 2006 23:46

Final ChopClose added based on similarity with "1r1pA" [LEE: 5, LME: 0, MR: 0, LG: 5, SS: 95.26, SI: 100, SO: 100]