CATH Domain: 1r12A01 XML data for domain: 1r12A01

Molscript image for 1r12A01
1r12A01
PDB coordinates for domain 1r12A01

PDB 1r12, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.82 ADP Ribosyl Cyclase; Chain A, domain 1
1.20.82.10 ADP Ribosyl Cyclase; Chain A, domain 1 Gene3D
1.20.82.10.2
1.20.82.10.2.1
1.20.82.10.2.1.1
1.20.82.10.2.1.1.1
1.20.82.10.2.1.1.1.1

[top]
Segment boundaries for domain 1r12A01

Chopping figure for domain 1r12A01
DomainStart PDB ResidueStop PDB Residue
1r12A01 1 67
1r12A01 100 151
1r12A02 68 99
1r12A02 152 251

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1r12A01
IVPTRELENVFLGRCKDYEITRYLDILPRVRSDCSALWKDFFKAFSFKNPCDLDLGSYKDFFTSAQQTLPGYMLNSLVWC
GQRANPGFNEKVCPDFKTCPVQARESFWGMASSSYAHSA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1r12A01
IVPTRELENVFLGRCKDYEITRYLDILPRVRSDCSALWKDFFKAFSFKNPCDLDLGSYKDFFTSAQQTLPGYMLNSLVWC
GQRANPGFNEKVCPDFKTCPVQARESFWGMASSSYAHSA
BLAST against CATH

[top]
Domain History Events (19)

Domain assigned by lewis on 09 Jan 2007 13:16

Assigning domain 1r12A01 to 1.20.82.10 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to the old domain 1r12A01 (from the previous chopping at "Sun Mar 5 17:39:16 2006") which was in 1.20.82.10 at the time the chain was unchopped.

Update comment by auto on 09 Jan 2007 11:45

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 07:39

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 03:39

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 23:43

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 20:18

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 15:38

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 11:40

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 07:33

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 03:34

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 23:27

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 19:32

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 15:44

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 11:45

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Flow stage update by auto on 07 Jan 2007 11:43

Domain "1r12A01" hits Domain "1lbeB01" (100% over 100%) which is currently in process

Flow stage update by auto on 07 Jan 2007 11:42

NW result present for Domain "1r12A01"

Flow stage update by auto on 23 Dec 2006 15:28

All required files are present for Domain "1r12A01"

Flow stage update by auto on 23 Dec 2006 11:29

Beginning processing for Domain "1r12A01"

Insertion by auto on 23 Dec 2006 11:22

Final ChopClose added based on similarity with "1lbeA"