CATH Domain: 1qz5A01 XML data for domain: 1qz5A01

Molscript image for 1qz5A01
1qz5A01
PDB coordinates for domain 1qz5A01

PDB 1qz5, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.2
3.30.420.40.2.1
3.30.420.40.2.1.1
3.30.420.40.2.1.1.1
3.30.420.40.2.1.1.1.1

[top]
Segment boundaries for domain 1qz5A01

Chopping figure for domain 1qz5A01
DomainStart PDB ResidueStop PDB Residue
1qz5A01 6 34
1qz5A01 71 134
1qz5A01 337 373
1qz5A02 35 68
1qz5A03 136 181
1qz5A03 271 332
1qz5A04 182 267

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.30.420.40.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2q0uA01 94.31 Actin, alpha skeletal muscleActin, alpha skeletal muscleOryctolagus cuniculus 3.30.420.40 149 96 85 1.73 2.03
2qxlB01 82.39 ATP bindingCytoplasmAdenyl-nucleotide exchange factor activityHeat shock protein homolog SSE1Peptide binding 3.30.420.40 134 8 76 3.67 4.77
1jceA01 82.06 Thermotoga maritimaRod shape-determining protein MreB and related proteinsRod shape-determining protein MreB 3.30.420.40 147 7 70 2.26 3.19
1e4fT03 79.30 Thermotoga maritimaCell division protein FtsA, putativeCell division protein FtsA 3.30.420.40 136 7 66 2.59 3.87
2d0oA01 78.78 Klebsiella oxytocaDiol dehydratase-reactivating factor large subunit 3.30.420.40 135 8 70 2.64 3.75
2ap1A01 76.97 Amino sugar and nucleotide sugar metabolismN-acetylglucosamine kinase [EC:2.7.1.59]Salmonella enterica subsp. enterica serovar TyphimuriumN-acetyl-D-glucosamine kinase 3.30.420.40 137 5 72 3.23 4.47
3h1qA01 76.05 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 152 6 65 3.22 4.94
1dt9A02 75.13 RNA bindingEukaryotic peptide chain release factor subunit 1Protein methylationProtein bindingCytoplasm 3.30.420.60 112 5 76 3.68 4.80
1nu0A00 74.20 Putative holliday junction resolvase [EC:3.1.-.-]Putative Holliday junction resolvaseEscherichia coli K-12 3.30.420.140 127 6 72 3.46 4.75
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1qz5A01
TALVCDNGSGLVKAGFAGDDAPRAVFPSIIEGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI
MFETFNVPAMYVYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1qz5A01
TALVCDNGSGLVKAGFAGDDAPRAVFPSIIEXGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQ
IMFETFNVPAMYVYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:39

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"