CATH Domain: 1qypA00 XML data for domain: 1qypA00

Molscript image for 1qypA00
1qypA00
PDB coordinates for domain 1qypA00

PDB 1qyp, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.25 N-terminal domain of TfIIb
2.20.25.10 Gene3D
2.20.25.10.15
2.20.25.10.15.1
2.20.25.10.15.1.1
2.20.25.10.15.1.1.1
2.20.25.10.15.1.1.1.1

[top]
Segment boundaries for domain 1qypA00

Chopping figure for domain 1qypA00
DomainStart PDB ResidueStop PDB Residue
1qypA00 1 57

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 2.20.25.10.15.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tfiA00 83.54 Transcription from RNA polymerase II promoterTranscription elongation factor S-IITranscription elongation factor A protein 1General RNA polymerase II transcription factor activityHomo sapiens 2.20.25.10 50 34 85 3.88 4.51
2js4A01 76.59 Hypothetical proteinBordetella bronchisepticaUPF0434 protein BB2007 2.20.25.10 47 8 57 2.43 4.20
1q16A03 68.75 Nitrogen metabolismTwo-component systemProtein bindingRespiratory nitrate reductase 1 alpha chainEscherichia coli K-12 2.20.25.90 47 4 40 1.91 4.73
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1qypA00
GSHMEQDLKTLPTTKITCPKCGNDTAYWWEMQTRAGDEPSTIFYKCTKCGHTWRSYE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1qypA00
GSHMEQDLKTLPTTKITCPKCGNDTAYWWEMQTRAGDEPSTIFYKCTKCGHTWRSYE
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1qyp000" to "1qypA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:47

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"